KEGG   Xanthomonas campestris pv. campestris 8004: XC_2472Help
Entry
XC_2472           CDS       T00247                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    XC_2472
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     XC_2472
Peptidoglycan biosynthesis and degradation proteins [BR:xcb01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   XC_2472
Chromosome and associated proteins [BR:xcb03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    XC_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 AMIN YdfZ DUF3215
Motif
Other DBs
NCBI-ProteinID: AAY49522
UniProt: A0A0H2XA26
Position
complement(2989411..2990571)
Genome map
AA seq 386 aa AA seqDB search
MRRRQVLHTVGAALLLSPRLVHAQPQPLLRSCNLQRQDAGLRLRLALSTQVAYRSFSLSN
PARLVIDLPGVSTQPPQVDPLPDGLAVVAIRSGPHGDGLRVVLDLAQPLTATARWEDGAL
VVDLAAVSGTASLSAADPTEPAVAAVAPTRSRLHPYVVAIDAGHGGKDPGAVSADARYEK
HVAMAVAGRLHQRLAADPRYRPTMIRSDDRFVALHERVMIAHRHNADLFVSIHADAAPSS
AARGASVFALSQGGASSALARWIADSENAADDMGDSARRLRVPSNPVLSQVLADLSLSGT
IASSLQFGKLMLDRLQHVTRLHQDQVGQAGFAVLKSPDIPSLLVETGFMSNRDDCNRLCG
DAHQDELAQTLHAGIDDYFQAFPGRA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggcggcaggtgttgcacaccgtcggtgcagccttgctgctgtcgccacgcttg
gtccacgcgcagccgcagccgctgctacgcagttgcaatctgcagcgtcaggatgcgggg
ctgcgacttcggctcgctttgagtacccaggtcgcctaccgcagcttcagcctgtccaat
ccagcgcgcttggtcatcgacctgccgggcgtttcgacgcaaccaccgcaggtcgatcca
ttgcctgacggtcttgcggtcgttgccatccgcagcggcccgcacggcgatgggctgcgc
gtggtgctcgatctggcgcagccgctaacagccacggcgcgctgggaggatggtgcactg
gtggtcgatcttgctgctgtgtccggcactgcgtcgttgtccgcagccgatccgaccgag
ccggccgttgcggcggttgcgcccacgcgctcccgcctgcatccctacgtggtcgccatc
gacgccggtcacggcggcaaggatcccggcgcggtcagtgccgatgcgcgctacgagaag
catgtggccatggcagtcgcggggcggctgcaccagcgcttggcggccgatccgcgttac
cggccgaccatgatccgcagcgacgatcgtttcgtggccttgcatgagcgcgtcatgatc
gcgcaccgacacaacgccgatctgttcgtgtcgatccatgccgatgccgcgcccagcagt
gccgcacgtggcgcctcggtgttcgctttgtcccaaggtggcgccagctcggcattggcg
cgctggatcgccgatagcgagaacgcggccgacgacatgggcgatagcgcgcgccgcctg
cgggtgccgagtaatccggtgttgtcgcaggtgctggccgacctgtcgctcagcggcacc
attgccagcagcctgcagttcggcaagctgatgctcgatcgcctgcagcacgtcacacga
ctgcatcaggaccaggtgggtcaggccgggtttgcagtgctgaaatcgcctgatatcccg
tcattgctggtggaaaccggcttcatgagcaatcgcgacgattgcaaccggctctgtggc
gacgcgcatcaggatgaactagcgcagacgctgcacgccggcatcgacgattacttccag
gcatttcccggtcgcgcctga

DBGET integrated database retrieval system