KEGG   Xanthomonas campestris pv. campestris 8004: XC_2474Help
Entry
XC_2474           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2991202..2991693
Genome map
AA seq 163 aa AA seqDB search
MQGEGKIMKNSKNWLMAFCVVAGMLSSGMAVAQCCANGGVGVHAMTGLGESNPKAANLTM
DPSLAIYELHRDGVTYLQINDVTGVVHAVVARVDNALWTLPMGKDVERVVLPAANRIAAG
TSSNNPPMLDSTQRDQARLVYKTKNFTVFNWREATGEHWIVSP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcagggggaaggcaaaatcatgaagaactcaaaaaattggcttatggctttttgcgtc
gttgctggaatgctgtcatcaggcatggcagtggctcagtgctgtgccaatggtggtgtc
ggcgtacatgcaatgacagggcttggcgaaagcaatcccaaggcagccaatctaacaatg
gatccttcgcttgccatttatgaactccatcgtgatggagtgacatatctccagatcaac
gacgtaactggcgtggtccacgcagtggtagcaagagtggacaacgcactctggaccttg
ccgatgggcaaggatgtagaacgtgtcgtgttgccggctgcaaacaggattgcagccggc
acgagttcaaacaatccgccaatgcttgattcaactcagcgtgatcaagcacgacttgtc
tacaaaacaaagaacttcacggtattcaactggcgggaagcaactggggaacactggata
gtctccccctga

DBGET integrated database retrieval system