KEGG   Xanthomonas campestris pv. campestris 8004: XC_2475Help
Entry
XC_2475           CDS       T00247                                 

Definition
(GenBank) sensor kinase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MASE1 MrpF_PhaF
Motif
Other DBs
NCBI-ProteinID: AAY49525
UniProt: A0A0H2X857
Position
complement(2991647..2993206)
Genome map
AA seq 519 aa AA seqDB search
MEPRSGGMAVAKELVRGMLISVCYCLAFLMLWRLSIDQWYLPVGLRVVTLLFRPYREWPF
LLAGDAAAMLFLRIPLGELQGFNPLWSYLSPFVHAPLIAGAIGLLRYQVPHIVKSQQWFI
PAALVIALWNAICSLVLNSTLGGPQAYPVLDLMLRYWSGSYLGMLVLLLPAMLWANWNDG
PVRLSLQRDLAIAVAVILSLFFLLGVSQEPLTRNILMVAMLVPMVVLTFRHGWKGSALGS
LLASFAIEFSLPRVYQIGFFDQQVFSMQLLYAVTTTVLFVFNARLREPARNKVSSQPGDD
AFTLARASYSSAERMLRNRVLEYSDINVQINKMRKDVVADLRGRGQHSAAMEMTRVSVLE
SQLLQQYVAALYPLEIETHGLYQALRSSALERFCQSQFQCVFRGDCRKLSLELQLSAYRS
TLNCVEILPPASRHFIQARAWTGKGARGVLVRVIADSSSAEAAKSDSIDVEAELKARLKA
HGGMFRRRHALVLTFLVAEPVSVAVRGRLSSVPQLLPAS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccaaggagtggtggtatggcggtagctaaagagcttgttaggggcatgctgatc
agcgtgtgctactgcttggcgtttctgatgctttggcgcttgtcgatcgaccaatggtat
ctgccagttgggttgcgcgtagtcactttgctgttccggccttaccgcgagtggcctttt
ctgttggcaggtgacgctgcggcgatgttgttcttgcgtattccgctgggcgaattgcag
ggatttaatccgttatggtcatatctgagtcccttcgtacatgcgcctttgattgctggg
gcgattggcctacttcgataccaagttcctcatattgttaaaagccagcaatggtttatt
cctgctgctcttgtcatagctctctggaacgctatatgcagcttggtgctaaactcgacc
ctcggtggaccgcaggcttatcctgtactagacctgatgttgcgctattggtcaggtagc
tatctgggcatgctggtcttgcttcttccggcgatgttatgggctaactggaatgatggt
cctgtacgcctgagtctccagcgagatcttgcaatcgcggtggctgttatcctaagtctg
ttttttttattaggggtctcgcaagagccattgactcgaaacatcttgatggtagcgatg
ctcgtgccaatggtcgtgttgactttcaggcacgggtggaaaggcagtgctctagggtca
ctattggcaagcttcgcaattgagttctcgcttcctcgggtgtatcagatcggttttttt
gatcaacaagtttttagtatgcagttgctctatgcggtcacgacgacagttctttttgtt
ttcaatgctcgtctgcgcgagccagcccgcaataaggtttcaagtcaaccaggagatgac
gccttcactctagcccgagccagctattctagtgctgagcgcatgctacgcaatcgagtg
ctggagtactctgacatcaatgttcagatcaacaagatgcgcaaagatgtggtggctgat
ttgagggggagagggcagcattctgcagcaatggaaatgacacgagtcagtgtccttgag
tcgcaattgcttcagcagtatgtcgccgcgctgtatccgttggaaatcgagacgcatggg
ctgtatcaggctctgcgttcgtcagcactcgagcgtttctgccagtctcagtttcaatgc
gtgtttcgcggtgactgcaggaagctatcgttggaacttcaattgagtgcttatcgcagt
actctcaattgtgtggagatcttgccgccggccagtcggcacttcatccaggctcgtgct
tggaccgggaaaggggctaggggcgtgttggtgcgtgtaattgctgattcgtcgtcagct
gaggcggccaagagcgactcgatcgatgtggaggctgaactgaaggcgcggttgaaagcg
catggcggcatgtttcgccgccgccatgcgctggttctgacctttctggttgccgagcca
gtctccgttgcggtcagggggagactatccagtgttccccagttgcttcccgccagttga

DBGET integrated database retrieval system