KEGG   Xanthomonas campestris pv. campestris 8004: XC_2478Help
Entry
XC_2478           CDS       T00247                                 

Definition
(GenBank) D-xylulokinase
  KO
K00854  
xylulokinase [EC:2.7.1.17]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XC_2478
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.17  xylulokinase
     XC_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2996457..2997950)
Genome map
AA seq 497 aa AA seqDB search
MSVYVGLDVGTQSVKLVAYDPQERAVVATIGAPMELISRDDGTREQQAQWWIDGIVHCFA
QLDAELRARVRGISVSGQQHGFVPVAADGSVTAPVKLWCDTSTALECDEIMDAVGGAAGS
VATAGNPIMAGYTASKLPWTRKHRPEAYAAMTTVMLPHDYVNFWLTGERFTEVGDASGTG
WLDVRTRQWSERMLGAMDAQRDLRDALPPLVETGAVFALSDAAAEALALPAGVRVTTGGG
DNMMAAIGTGNVVPGRLTMSLGTSGTLFAYADHPVVDDDARWAAFCSSSGGWLPLICTMN
CTVATEAVMRMFSITRAQTEAMIADTTPGADGLVLLPFFNGERTPNLPDARGCLFGMDLH
NTTPAHFYRAAMEGATYSLRNGFDAFVAAGLQFDTILLTGGGSKSAQWRQMVADVFNLQV
VVPTQPEGAAFGAALQAVWACDRDDGGQAALSEVVLEHLQIDDALSARPDPQRVAAYQQH
YQNFLKHLHVVSPLYAG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgtacgtaggactggatgtcggcacacagagcgtcaagctggtggcctacgat
ccgcaggagcgcgctgtggtcgccaccatcggcgcgccgatggaattgatcagccgcgac
gatggcacccgcgagcagcaggcgcagtggtggatcgacggcatcgtgcattgcttcgcg
cagctcgatgccgagctgcgtgcgcgcgtgcgcggcatctcggtgtccgggcagcagcat
ggcttcgtgccggtggccgccgatggcagcgtcaccgcgccggtgaagctgtggtgcgat
accagcaccgcgctggaatgcgacgagatcatggatgcggtgggcggtgcggcaggcagc
gtggccaccgccggcaacccgatcatggccggctacacggcatccaaattgccgtggacg
cgcaagcatcgccccgaggcgtatgcggcgatgaccacggtgatgttgccgcatgactac
gtgaacttctggctcaccggcgagcgcttcaccgaggtgggtgatgcctccgggaccggt
tggctggatgtgcgcacccgccagtggtccgagcgcatgcttggcgcgatggatgcgcaa
cgcgatctgcgcgatgccttgccgccgctggtggagaccggcgcagtgttcgccctgtcc
gatgcagctgcagaagcgctcgcattgccggccggcgtgcgcgtcaccaccggcggtggc
gacaacatgatggcggcgatcggtaccggcaatgtggtgcccggccgcctgaccatgagc
ctgggcacctccggcaccttgtttgcctacgccgatcatccagtggtggacgacgacgca
cgctgggccgcgttttgctcgtccagcggtggctggttgccgttgatctgcaccatgaac
tgcaccgtggccaccgaagcggtgatgcgcatgttctccatcacccgtgcgcagaccgag
gccatgatcgccgacaccacgcccggtgccgacgggctggtgctgttgccgttcttcaac
ggcgagcgcacacccaatctgccggatgcgcgtggctgcctgttcggcatggatctgcac
aacaccacgccggcgcatttctatcgcgcggcgatggaaggggccacctacagcctgcgc
aatggcttcgacgcctttgtcgccgccggcctgcagttcgataccatcctgctcaccggc
ggcggcagcaagagcgcgcagtggcggcagatggtggccgacgtgttcaacctgcaggtg
gtggtgccgacccagcccgaaggcgcggcgtttggtgccgcgctgcaggcggtgtgggcc
tgcgaccgcgacgatggcggccaggccgcgttgtcggaggtggtgctggagcacctgcag
atcgacgatgcattgtcggcgcgcccggatccgcaacgcgtggccgcctaccagcagcac
taccagaacttcctcaagcacctgcacgtcgtcagcccgctctacgccggctga

DBGET integrated database retrieval system