KEGG   Xanthomonas campestris pv. campestris 8004: XC_2487Help
Entry
XC_2487           CDS       T00247                                 

Definition
(GenBank) 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase
  KO
K01631  
2-dehydro-3-deoxyphosphogalactonate aldolase [EC:4.1.2.21]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Galactose metabolism
Metabolic pathways
Module
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XC_2487
Enzymes [BR:xcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.21  2-dehydro-3-deoxy-6-phosphogalactonate aldolase
     XC_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3017323..3017961
Genome map
AA seq 212 aa AA seqDB search
MTASTTPVFNPFALPLVAILRGITPEDTLAHVGALIDAGFDAIEIPLNSPRWAESIALAQ
QRYGARAWIGAGTVLRNEDVDTLAGIGARFIVTPNTKPSLIRHAVSRGLTVVAGFATASE
AFDAIDAGAQILKLFPAATYGAAHVRALRSVLPTHVPVYVVGGVSPQTLAGFMAQGAAGA
GIGGELYKPGQSLETTQTHARAFVQAYQELQG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatccaccacccccgtgttcaacccgttcgccctgccgctggtcgccatcctg
cgtggcatcaccccggaagacacgctggcgcatgtcggtgccttgatcgacgccggattc
gacgcgatcgagatcccgctcaactcgccacgctgggccgagagcattgccctggcgcag
cagcgctacggcgcgcgcgcctggatcggcgccggcaccgtgctgcgcaacgaagacgtc
gacacgctggccgggatcggcgcgcgtttcatcgtcacccccaataccaagccttcgctg
atccgccatgcggtgtcgcgcgggctgaccgtggtggccggctttgccaccgccagcgaa
gccttcgatgccatcgacgccggcgcgcagatcctcaaactgttccccgcggccacctat
ggcgcggcgcatgtgcgcgccttgcgctcggtgctgccgacccacgtgccggtttacgtg
gtcggcggagtgagcccgcagaccctggccggcttcatggcgcagggcgccgccggcgcc
ggcatcggcggcgaactgtacaaacccggccaatccctcgaaacaacccagacgcatgca
cgcgcctttgtgcaggcttaccaggaactgcaaggatga

DBGET integrated database retrieval system