KEGG   Xanthomonas campestris pv. campestris 8004: XC_2488Help
Entry
XC_2488           CDS       T00247                                 

Definition
(GenBank) 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase
  KO
K01684  
galactonate dehydratase [EC:4.2.1.6]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Galactose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XC_2488
Enzymes [BR:xcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.6  galactonate dehydratase
     XC_2488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3017958..3019106
Genome map
AA seq 382 aa AA seqDB search
MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAGYVVGKDPARI
NDLWQTMYRAGFYRGGAILMSAIAGIDQALWDIKGKALGVPVYELLGGLVRDRMKTYRWV
GGDRPGAIIAQINDYRALGFDTFKFNGTEEMKLIDSARAVDAAVVKVAEIRETFGNSIDF
GIDFHGRVGAPMAKALLRELEPFKPLFVEEPVLAEQAEYYPRLAASTCIPLAAGERMFSR
FEFKNVLCAGGIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
FVSHNAVLQEQSIGIHYNEGADLLDYVINKEDFHCVDGSIAALPKPGLGVEINEDMLKRA
NENPPDWRNPVWRHADGSIAEW
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcacccgcctcaccacctaccacgccgcaccgcgctggttgttcctcaaggtc
gaaaccgacgagggcatcaccggctggggcgagccggtcatcgaaggccgtgcgcgcagc
gtggaagcggccgtgcacgagctggccggctacgtggtcggcaaggatccggcccgcatc
aatgacctgtggcagaccatgtaccgcgccggcttttaccgaggcggcgctattttgatg
agcgccatcgccggcatcgaccaggcgctgtgggacatcaagggcaaggcgcttggcgtg
ccggtgtacgagctgctgggcgggctggtgcgtgatcgcatgaagacctaccgctgggtc
ggcggcgaccgcccgggcgcaatcatcgcgcagatcaacgattaccgtgcgctgggcttt
gacaccttcaagttcaacggcaccgaagaaatgaagctgatcgacagcgcgcgtgcggtc
gatgcggcagtggtcaaggtggccgaaatccgcgagaccttcggcaatagcatcgatttc
ggcatcgacttccacggccgcgtcggcgcgccgatggccaaggcgctgctgcgcgagctc
gaaccgttcaagccgctgttcgtcgaagaaccggtgctggccgaacaggccgagtactac
ccgcgcctggccgcgagcacctgcattccgttggctgccggcgagcgcatgttctcgcgc
ttcgagttcaagaacgtgctgtgcgccggcggcatcggcatggtgcagccggacctgtcg
catgccggtggcatcaccgagtgcgtcaagatcgccgccatggccgaagcctacgatgtg
ggcttcgcaccacactgcccgctcggcccgatcgcgctggctgcctgcctgcacgtggac
ttcgtttcgcacaatgccgtgctgcaggaacagagcatcggcatccactacaacgaaggc
gccgacctgctcgattacgtcatcaacaaagaagattttcactgtgtggatggcagcatt
gccgcactgcccaagcccgggctcggtgtggagatcaacgaagacatgctcaagcgcgca
aacgaaaatccgccggactggcgcaacccggtgtggcgtcacgccgacggcagcatcgcc
gaatggtga

DBGET integrated database retrieval system