KEGG   Xanthomonas campestris pv. campestris 8004: XC_2500Help
Entry
XC_2500           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3027365..3028216
Genome map
AA seq 283 aa AA seqDB search
MGLINAAHTAIAADGHGWQLLHYAPAQPIASLLWLPALGVAARHYAPFAQALAERGIAVF
VHEWRGNGSSTLRASRHHDWGFRTLLEHDLPASQAIVAAQSPPLPRLLGGHSLGGQLACC
HAALHPGNAARLWLVASGSPYWRNFPSPLRYGLPLAYRFLPWLARVQGVLHGRRLGFAGT
EARSLIADWARVGRSNRYRAAGAPWDLEQALASVTCPVDGVVFARDRFGPATALHALCAK
MPQAPTTLRLLDDAALGMRSDHFAWMRAPIAVAAALRTSLHDR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggattgatcaacgccgcacacacggccatcgcggcggatgggcacggctggcagctg
ctgcactacgcgcctgcgcagccgatcgccagcctgttgtggttacctgcattgggcgtg
gcggcccggcactacgcgccattcgcgcaggcattggccgagcgcggcattgcggtcttc
gtgcacgaatggcgtggcaacggcagcagcaccttgcgtgcatcgcgtcaccacgattgg
gggtttcgcaccctgcttgaacatgatctgccggccagccaggccattgtcgctgcgcag
tcaccgccgctgccgcggctgctgggcggccacagcctgggtgggcaactggcctgctgc
catgccgcgttgcatccgggcaatgcggcgcgcctgtggctggtcgccagcggctcgccg
tactggcgcaactttccgtcaccgctgcgttatgggctgccgttggcgtaccggttcctg
ccatggctggcacgtgtgcaaggcgtgctgcacgggcggcggctcggctttgcggggacc
gaagcgcgcagcctgatcgccgactgggcgcgcgtcggccgcagcaatcgctaccgcgct
gcgggcgcaccgtgggatctggagcaggcactggccagtgtcacctgcccggtcgacggt
gtggtgttcgcacgcgaccgcttcggccccgctacagcgctgcacgcgctttgcgccaag
atgccgcaggcgcccacgacgctgcgcctgctcgacgacgcagcgctgggcatgcgcagc
gaccatttcgcgtggatgcgcgcacccatcgcggtcgccgctgcgttacgcacgtcgctg
cacgatcgatag

DBGET integrated database retrieval system