KEGG   Xanthomonas campestris pv. campestris 8004: XC_2501Help
Entry
XC_2501           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc Rhodanese TPR_21
Motif
Other DBs
NCBI-ProteinID: AAY49551
UniProt: A0A0H2XA23
Position
complement(3028600..3029592)
Genome map
AA seq 330 aa AA seqDB search
MQGLIEQYGLALVFANVLALSLGLPVPAMPTLVLVGAGYALHGGSAAWSAALAALAVSVF
ASVLGDLVWYLAGRRFGNRTLQSLCRLSLSRDTCMKKTERFFGRWGVRVLAVAKFVPGLS
MVSVPMAGAMQVRPGAFLRYDAFGALLWAAVGLGLGALFADQVQDVLHFLSTLGSGAVLV
VALLLAGYVGWRWWRRHTLLRSLETARIAVEELVPMLAADEAMRPAVLDIRAQGFRDLQP
YTIPGAVFADERELAQILATVPRDRSVVIYCACPDEVSAAWLAGRLRERGYRDVRPLLGG
LDAWRDAGHPVVSLVPLATLAPTGEAGALA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcttgatcgaacagtacggattggcgctggtgttcgccaacgtgctggcgttg
tcgctcggtctgccggtgccggccatgccgaccctggtgctggtgggcgccggctatgcc
ttgcatggcggcagcgccgcgtggagtgccgcgctggcagcactggctgtttcggtattc
gccagcgtgctgggcgatctggtctggtatctggccgggcgccgtttcggcaatcgcacc
ttgcagtcgctgtgccggctgtcgctgtcgcgcgatacctgcatgaagaagaccgagcgt
tttttcgggcgctggggcgtacgcgtgctggcggtggccaagttcgtgcctggcctgtcg
atggtatcggtgccgatggcgggcgcgatgcaggtgcggccaggagcattcctgcgctac
gacgcgtttggcgcgttgctgtgggcagcggtggggcttgggttgggcgcgctgttcgcc
gatcaggtgcaggacgtgctgcactttctctccacgctgggctcgggcgccgtgctggtg
gtggcgttgctgttggccggttatgtcggctggcgctggtggcgccgccatacgctgctg
cgctcgctggagaccgcgcgcattgcggtcgaagaactggtgccgatgctcgccgccgac
gaagcgatgcggccggcggtgctggatatccgcgcgcagggctttcgcgatctgcagccg
tacacgattcccggtgcggtgtttgccgatgagcgcgagctggcgcagattctggcaacg
gtgccgcgcgatcgcagcgtggtgatctattgcgcctgcccggatgaagtgtccgccgcc
tggttggctgggcgcttgcgcgagcgcgggtatcgcgatgtgcgtccgctactgggtggg
ctggatgcctggcgcgatgcggggcatccggtggtgtcactggtgccattggccacgctt
gcgccgaccggcgaagcgggcgcactggcctga

DBGET integrated database retrieval system