KEGG   Xanthomonas campestris pv. campestris 8004: XC_2502Help
Entry
XC_2502           CDS       T00247                                 

Definition
(GenBank) transcriptional regulator
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 Neuralized
Motif
Other DBs
NCBI-ProteinID: AAY49552
UniProt: A0A0H2X877
Position
complement(3029637..3030581)
Genome map
AA seq 314 aa AA seqDB search
MKISLDALQILDAIDRRGSFTAAAKVLFKVPSTISYTVAKLEEDLGVQLFERVGPKATPT
QAGRELLREGRQLLRAAQELEVRVRRVASGWESEFAIGLDAVLPASLLLPQLLDFYRIAD
STRLRVVSESLSGSWEALLDRRVDLVVAAGEGPSGGGYVAEPIGSLRFVFAVAATHPLVD
AGVLGVAELAEHRAIAAADSARRLLPRTVGLLSGRDVLTVPDMQTKLQLQLAGAGYGFLP
EPYARGALQAGALRALAVETHKPDETFYLAWRPGEEGEALSWWRQALRSEGLFARWLEQL
AETYRSVPTGQPVA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagcctggatgcgttgcagatcctggacgcgatcgaccgccgtggctctttc
actgccgcggcgaaggtgttgttcaaggtgccgtcgacgatctcctacacggtcgccaag
ctggaggaggacctgggcgttcagttgttcgagcgcgttggccccaaggccacgccaacg
caggccggccgcgagctgttgcgtgaggggcggcaattgctgcgcgcggcgcaggagctg
gaagtgcgggtgcggcgggtcgcctccggctgggagtcggagttcgccattggtctggac
gcggtgctgccggcgtcattgctgctgccgcaattgctggacttctatcgcatcgctgac
agcacccggttgcgcgtggtgagcgagtcgctctccggtagctgggaggcgctgctggat
cgacgtgtggatctggtggttgctgctggcgaggggccgagcggtggcggttatgtcgcc
gagccgatcggctcgctgcggttcgtgttcgcagtggccgccacgcacccgctggtggac
gccggagtgctgggcgtggcggagctggccgagcatcgcgcgatcgcggcagcggactcc
gcacgccggctgctgccacgcacggtggggctgctgtccggccgcgacgtgcttaccgtg
ccggacatgcagaccaagttgcagctgcagctggctggggccggctatggcttcctgccc
gagccgtacgcgcgcggcgcattgcaggccggcgccctgcgcgcgcttgcggtggaaacg
cacaagccggacgagacgttctacctggcgtggcgtccgggcgaggagggcgaggcgcta
agttggtggcggcaggcgctgcgcagcgaggggttatttgcgcgctggctggagcagctg
gccgaaacgtatcgttccgtccccaccgggcagccggtagcgtag

DBGET integrated database retrieval system