KEGG   Xanthomonas campestris pv. campestris 8004: XC_2511Help
Entry
XC_2511           CDS       T00247                                 

Definition
(GenBank) ubiquinone biosynthesis protein
  KO
K03688  ubiquinone biosynthesis protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC1 Pkinase T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: AAY49561
UniProt: A0A0H2X880
Position
complement(3040910..3042586)
Genome map
AA seq 558 aa AA seqDB search
MWEALGTVRDLGRLQEIASVLIRYGFGDVVRRIGLADVLERAGRLLHWTNAEGRLRMSAA
TRVRRALEELGPTFVKLGQVLATRVDLLPPDWIEELSELQNAVPALPFAHIRPQLVAALG
MEPEQVFARLDEEPLAAASLAQTHRAWLADGTAVVLKIRRPGIGDTIDADLRLLARLAEI
VETRAPDLKRYRPAEVVQQFTLSLRRELDFAAECRNAERIAANFANDPQILIPAVHWEWT
CESLNVQDFVDGIPGRDLVAVDAAGLDRKALARTGAGIVLKMVLQDGCFHADPHPGNIFY
LRDGRIAVIDFGMVGRISEQRRFQVAQLLHGMVSYDAESVIDVLLEWAGTSLDIDEPRLQ
QDIGAFVDAYRGVPLKELRIGAMLGDVTAILRDHGLTLPSDLALMIKAFLTLEGMGRQLD
PDFDMASEARPYLERVVLQRYAPSAMLRRGRRTVTGAIDLIGDLPRDLKRLIQAARRGKL
QLHVETRALREFGEQVDRAANRLTMGIVTAALVIGSSIVMNSVGGIASRWLLALGVSGFI
GAALCGVWILFSIWRSRR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaagcacttggcaccgtccgtgaccttgggcgcctgcaggaaatcgcatccgtc
ctgatccgctatggcttcggcgatgtggtgcggcggatcggcctggccgacgtgctggag
cgtgcgggccggctgttgcactggaccaatgccgaaggccgtctgcgcatgtccgcggcc
acgcgtgtccgtcgcgccttggaagagctcggtccaaccttcgtcaagcttgggcaggtg
ttggccacgcgcgtggatctgttgccgccagactggatcgaggaactcagcgagctgcag
aacgccgtgccggcgctgccgttcgcacacatccgcccgcaactggtggccgcgctggga
atggaaccggagcaggtcttcgcgcggctggatgaagagccactggcggccgcatcgctg
gcgcagacgcatcgcgcctggctggccgacggcaccgcggtggtgctcaagatccggcgc
cccggcatcggcgacaccatcgatgccgacctgcgtctgctcgcacggctggccgaaatc
gtcgaaacccgcgcgccggatctgaagcgctatcgccccgccgaagtggtgcagcagttc
acgctgtcgctgcgccgcgagctcgatttcgccgccgagtgccgcaatgccgagcgcatc
gccgccaacttcgccaacgatccacagatcctcattcccgccgtgcattgggaatggacc
tgcgagtcgctcaacgtgcaggacttcgtcgacggcattcccgggcgcgatcttgttgct
gtggatgccgccggcctggaccgcaaggcgctggcacgcaccggcgccggcatcgtgttg
aagatggtgctgcaggacggctgttttcatgccgatccgcatcccggcaatattttctat
ctgcgcgacgggcgcatcgcggtcatcgacttcggcatggtcgggcgcatttccgaacag
cgccgcttccaggtcgcgcaactgttgcacggcatggtgagctacgacgccgagtcggtg
atcgacgtgttgctggaatgggcaggcaccagcctggacatcgacgagccgcgcctgcaa
caggacatcggcgccttcgtcgatgcttatcgtggcgtaccgctcaaggagctgcgtatc
ggcgcgatgctgggcgatgtcactgccatcctgcgcgatcacgggctgacgttgccatcg
gacctggcgctgatgatcaaggccttcctcaccctggaaggcatggggcgccagctcgac
ccggatttcgacatggccagcgaagcgcgcccctatctcgaacgcgtggtgctgcagcgg
tacgcgcccagcgcgatgctgcggcgtggccggcgcacggtgaccggggcgatcgacctg
atcggcgatctgccgcgcgatctcaagcggctgatccaggccgcgcgtcgcggcaagctg
cagctgcacgtggaaacgcgagccttgcgcgaattcggcgagcaggtcgaccgcgccgcc
aaccgcctcaccatgggaatcgtcaccgccgcgctggtgattggctcgtcgatcgtgatg
aacagcgttggcggcattgccagccgctggctgctggcactgggcgtcagcgggttcatc
ggcgcggcgttgtgcggggtctggatcctgttttcgatctggcgcagccgccgctga

DBGET integrated database retrieval system