KEGG   Xanthomonas campestris pv. campestris 8004: XC_2512Help
Entry
XC_2512           CDS       T00247                                 

Definition
(GenBank) TonB-dependent receptor
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3043011..3045674)
Genome map
AA seq 887 aa AA seqDB search
MDSVMRPLRRCANGSVACDISRGRRRMMQSQRLTASPPGNPMHIDHRRGGRLALAIFVAT
HAPWLYAQAQSDAPAERTEPATLAALTVTAQKREEALQDVPIIVSVLPEQLLLDNGVHDI
KDLQVLVPGLIVTSTQSAAQTTARIRGIGTVGDNAGLESSVGVVIDGVPRARNGVGFSDL
GELERIEVLKGPQGTVFGKNTSAGVINVVTRRPSFTRSAEAELTAGNYGAFGLAAAFNDA
VGETSALRVYAAKRRRDGFENVVTGAGPRTATDDGDQNLETGRIQLLWEPSHELAINIAA
DATNRNENCCVTVTTERGPTAAILNALTPGGQGTIGQADPSRRLAYSNRSTAQDIRDRGV
SAQVDWTTPWLGAPVLTSITALRDWTSVNGLDFDFSAADVLYRAPQQDEMLTGFRTFSQE
LRLAGSSEQLDWMVGAFYADETVHRNESYRFGTAYEPYLSTALLGRINPALAARADAPRF
LADATGLPTGSLFRGQGSQDRFRQDGRSVAVFTNNTWHATDALDVVVGLRYTYEHKALAS
SFENPDGSPACASYFAANGQLDPAAARRIGAALTARGVPAAAVPSIAPQVVGFSCLPWSN
VAHDGRRTQQQLTEREWSGTAKLAYRWNDALMTYVSAARGYKAGGFNLDRVQSADGLSTG
VQGIVPVDDTAFPGEFVDSYELGAKTTWLGGNLLLNAALFYQDFSDFQLNNFLGTSFVVR
AIPTVISQGVDAEVLWQTGLPGLMLQGGLSYTDTAYGQDRLPDADLALLPGSRTSFAPRL
SGNLALSYEHAIGSQLIGRANLGAKYSSDYNVGTDLDPQKLQPSYTIVNARLGIGASDKR
WQLEAWAENLGNVTYRQVAIDAPLQAGSWNAFLGAPRTFGMTLRLRY
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atggattcggtcatgcgcccgctgcgtagatgcgcgaacggtagcgttgcttgtgacata
tctcgcggccgtcgccgcatgatgcagtcgcagcgtctcaccgcctcaccgccgggaaac
ccaatgcatatcgatcaccgacgcggtggcaggcttgcgcttgccatcttcgtagcgacg
cacgcgccctggctgtacgcacaagcgcagagtgacgcgcctgccgaacgcacggaacca
gcgaccttggccgccttgacggtcactgcgcagaagcgcgaagaagcattgcaggacgta
ccgatcatcgtttcggtgctgcccgagcaactgttgctggacaacggcgtccacgacatc
aaggatttgcaggtgctggtgccgggattgatcgtcaccagtacccagagcgctgcgcaa
accactgcacgtatccgcggcatcggcacggtgggcgataacgcaggcctggaatcttcg
gtgggcgtggtgatcgacggggtgccgcgtgcgcgtaacggtgtggggttctcggacctc
ggcgagctggaacgcatcgaggtgctgaagggtcctcagggcaccgtattcggcaagaac
acctcggccggcgtcatcaatgtggtgacgcgccgccccagcttcacgcgtagcgcggaa
gcagaactgacggccggcaactacggagcgttcggtctggctgcggcattcaacgatgca
gtgggagaaaccagcgcgctgcgcgtctatgccgccaaacgccgccgcgacgggtttgaa
aatgtcgtgactggtgccggcccgcgcacggcgaccgacgacggcgaccagaatctggag
accggccgcatccagctgctgtgggagccgtcgcatgaactggccatcaatatcgccgcc
gatgccaccaatcgcaacgagaactgctgtgtcaccgtcaccaccgagcgtgggccgacc
gccgcgatcctcaacgcgctgacgccaggcgggcagggcaccatcgggcaggcggatccg
tcccggcggctggcctacagcaatcgcagcaccgcgcaggacattcgcgaccgtggggtg
tcggcgcaggtggactggaccacgccctggctgggcgcgccggtgctgacgtcgatcacc
gcgttacgtgactggacctcggtcaacggcctggatttcgatttcagtgccgcagacgtg
ctgtaccgcgcaccgcagcaggatgaaatgctcaccgggttcagaaccttcagccaggag
ctgcggctggccggttccagtgagcagctggactggatggtgggcgcgttttacgccgat
gaaaccgtgcatcgcaacgagtcgtaccgctttggaacggcctacgagccgtacctctcc
acggcgctgttaggacgcatcaatccggcgctggccgcacgtgcggatgcaccgcgcttt
ctcgccgatgccaccggcctgcccaccggttcgctgtttcgcggccagggcagccaggac
cgcttccgccaggatggccggagcgttgccgtgttcaccaacaatacctggcatgccacc
gatgcgctggatgtggtggtggggctgcgctacacctacgaacacaaagcgctggcttcc
tcgttcgagaacccggatggcagcccagcctgcgcgagctacttcgccgcgaacgggcag
ctggatccggctgcggcgcgacgcattggtgcggcgctgactgcgcgtggcgtaccggca
gcagccgtgccgagcatcgctccgcaagtggtgggctttagctgcctgccgtggagcaat
gtggcgcatgacggccgcaggacccagcaacaactgacggagcgcgaatggtccggcact
gccaagctggcgtatcgctggaacgacgcgctgatgacgtatgtgtcggcggcgcgcggc
tacaaggctggcggcttcaacctggaccgcgtgcaatctgctgacggtttgtccacgggc
gtgcaaggcatcgtgccagtggacgacaccgccttcccgggcgagttcgtcgacagttac
gagcttggcgccaaaaccacgtggttgggtggcaacctgctactgaacgccgcgttgttc
taccaggatttcagcgacttccagctcaataattttctgggcaccagcttcgtggtgcgc
gccattcccacggtgatctcgcaaggcgtggacgcggaagtgctgtggcagacggggttg
cccggcctgatgctgcaaggtggcctcagctatacggataccgcctacggtcaggaccgc
ctgcccgatgcggacctggcattgctgcccggcagccgtacgagttttgcgccgcgcttg
tctggcaacctcgcgctgagctacgaacacgcgatcggcagccagctgatcggtcgtgcc
aatctgggcgccaagtacagctccgattacaacgtcggcaccgacctggatccgcagaag
ctgcagccgtcctacaccatcgtcaacgcgcgattgggcatcggcgccagcgataaacgc
tggcaactggaagcctgggcagagaaccttggtaatgtcacctatcggcaggtggccatc
gatgcaccgctgcaggccggctcgtggaatgcatttttgggtgcgccacgcaccttcggc
atgacgctgcgcttgcgctactga

DBGET integrated database retrieval system