KEGG   Xanthomonas campestris pv. campestris 8004: XC_2517Help
Entry
XC_2517           CDS       T00247                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XC_2517
Enzymes [BR:xcb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XC_2517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3049632..3050540)
Genome map
AA seq 302 aa AA seqDB search
MPMFDTTPQLNCAGRLLRLDGPQVMGIVNVTPDSFSDGGQHTTVDAAVAHGLRLVAEGAA
VLDVGGESTRPGANAVSVEEELQRVIPVIQALSAQTAVPISVDTYKPEVMRAAVGAGAGM
INDVHALRSPGALEAAAELAVPVVLMHARSAPHAMQAEPHYDDVVAEVHRFLAERIFAAE
MAGIDKRRLILDPGFGFDKSTAHNLTVLAQLQRLQEFGLPVLAGFSRKRTIGELTGRQVA
ADRVHGSVAAHLIAAQQGAQLLRVHDVAATVDALKVWRAVAAIPTPRAAAPAAPTIRWPD
ED
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttgccgatgtttgacaccacaccgcaattgaactgcgccggccgcctcctgcgcctggat
ggcccgcaggtgatgggcatcgtcaatgtcacgccggactcgttctccgatggcggtcag
cacacgacggtggacgcggcggtggcccatgggctgcgactggtcgcagaaggtgcggcg
gtgctggatgtgggcggtgaatccacccggcctggcgccaatgcggtatcggtggaagag
gagctgcagcgggtgatcccggtgatccaggccctgagcgcgcagaccgctgtgccgatc
agcgtggacacctacaagcccgaggtcatgcgcgccgcagtcggcgcgggcgcgggcatg
atcaacgatgtacacgcgttgcggtcgccgggcgcgctggaggcggctgcggaactcgcg
gtgccggtggtgctgatgcatgcgcgcagcgcaccgcatgcgatgcaggccgagccgcat
tacgacgatgtggtggccgaggtgcatcgctttctggccgagcgtatttttgctgcggaa
atggccggcatcgacaagcgtcggctgatcctcgaccccggattcggcttcgacaagagc
accgcgcacaacctcaccgtgctggcgcaactgcagcggctgcaagaatttggcctgccg
gtgctggcgggattctcgcgcaagcgcacgatcggtgaattgaccggtcgccaggttgcg
gccgaccgcgtgcatggctcggtggccgcgcatctgatcgccgcccagcagggcgcgcaa
ctgctgcgcgtgcatgacgtggcggcgaccgtggatgcgttgaaggtatggcgtgcggtg
gctgcaattcccaccccgcgcgcggcagcacctgcggcgccgacgattcgctggccggac
gaggactga

DBGET integrated database retrieval system