KEGG   Xanthomonas campestris pv. campestris 8004: XC_2523Help
Entry
XC_2523           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc DUF1056
Motif
Other DBs
NCBI-ProteinID: AAY49573
UniProt: A0A0H2XA37
Position
complement(3055208..3055822)
Genome map
AA seq 204 aa AA seqDB search
MKIFGPLYDVAIRWSRHRRAPALLTGLSFVEGFIFPVPPEVMLAPMSLAEPRRALWFATL
SLIGSLSGALVGYLLGHFAFAALQPLIEWLGWSARIDEQVQNLRQVVAESPWKAFWLLVI
VGFTPIPLKIFTWASGVVGVPILPFIASMLVGRGKRVYLVAGAIRLGGARAEAALHRWIE
PLGWVAMAVLAVVAGWLVWKATNG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattcgggccgttgtacgacgtggccatccgttggtcccgccaccgccgcgca
ccagcgctgctgaccggcctcagtttcgtcgagggcttcatctttccggtcccgccggaa
gtgatgctggcgccgatgtcgctggcagagccgcgacgcgcgctgtggttcgccacgttg
agcctgatcggatcgctcagcggtgcgctggtgggctatctgcttggccacttcgcgttc
gctgccttgcagccgctgatcgagtggctgggctggagcgcgcgcatcgacgagcaggtg
cagaacctgcggcaggtggtggccgaatcgccgtggaaggcgttctggttgctggtgatc
gtgggctttacgcccattcccttgaagatctttacctgggcctcgggcgtggtcggcgtg
ccgatcctgccgttcatcgccagcatgctggtggggcgcggcaagcgcgtgtacctggtg
gccggcgcgatccgtcttggcggcgcgcgcgcggaagccgcgctgcaccgctggatcgaa
cccctgggctgggtggcgatggcggtcctggcggtggtggccggctggctggtgtggaag
gcaacgaacggatga

DBGET integrated database retrieval system