KEGG   Xanthomonas campestris pv. campestris 8004: XC_2526Help
Entry
XC_2526           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Smr
Motif
Other DBs
NCBI-ProteinID: AAY49576
UniProt: A0A0H2X887
Position
3057388..3057933
Genome map
AA seq 181 aa AA seqDB search
MTMSHPEDEDDGALFRAAIGEVKPIRAVAPPANTKPRPKPRARMAERDEAEAQSEFARLL
RDSSPLEAGDTASYRRDTLPARLFQRLKRGQFSVQDELDLHGATAVQADALLRQFLLEAH
AHEHGCVRIIHGKGLQSDSGAPVLKNLVDRVLRQRNDVLAFHSAPPTQGGTGALLVLLAR
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgtcgcatcctgaagacgaagacgacggcgcgctgttccgtgcagccattggc
gaagtgaagccgatccgcgccgttgcgccgcccgccaacaccaagccgcggccaaagccg
cgtgcgcgtatggccgagcgcgacgaagccgaggcgcagagcgaatttgcgcgcctgctg
cgtgattcttcgccgctggaagctggtgacaccgccagctaccgccgcgataccctgccc
gcgcggctgttccagcgactcaagcgcgggcagttttcggtgcaggacgaactggacctg
cacggcgccactgccgtacaagccgacgccttgctacgccagtttttgctcgaggcgcat
gcacacgagcacggctgcgtgcgcatcatccacggcaagggcctgcaatcggacagtggc
gcaccggtgctgaagaatctggtcgaccgtgtgctgcgtcagcgcaacgatgtgctggcc
ttccattccgcaccgccgacgcaaggtggaaccggcgccttgctggtgttgttggcacga
cgttag

DBGET integrated database retrieval system