KEGG   Xanthomonas campestris pv. campestris 8004: XC_2553Help
Entry
XC_2553           CDS       T00247                                 

Definition
(GenBank) biotin synthesis protein
  KO
K02169  malonyl-CoA O-methyltransferase [EC:2.1.1.197]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00780  Biotin metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    XC_2553
Enzymes [BR:xcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.197  malonyl-[acyl-carrier protein] O-methyltransferase
     XC_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran Methyltransf_9 PrmA Cons_hypoth95 CMAS Methyltransf_8 MTS Methyltransf_32 Methyltransf_33 Methyltransf_20 TPMT Methyltransf_18 Peripla_BP_6 PCMT Methyltransf_PK
Motif
Other DBs
NCBI-ProteinID: AAY49603
UniProt: A0A0H2X8A1
Position
complement(3087612..3088322)
Genome map
AA seq 236 aa AA seqDB search
MNSAMSSVPTLEPAAAYALWAQAYPPHAHNPVMLAEQRAMLALLPTDLRSQHVLDAGCGS
GRYMLQALQRGAAQVTGVDLSPEMLQRAAHELAQRWPATCFSLQQGSLEQLPVADAMADI
TVCGLVVGHLPRLWTALEQLRRVTRIGGSVLCSDVHPIGHALGWRRDFKADGQHYAIRHT
QHLYSHWHSACAALDLAIEAVAEPMLDPADIPPGARFDTAALQVPVALVLRLRRLA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgcaatgagcagtgtgcccacgctggagccggccgcagcgtatgcgctgtgg
gcgcaggcgtatccgccgcacgcgcacaacccggtgatgctcgccgagcagcgcgccatg
ctggcgctgttgcccaccgacctgcgcagccagcatgtgctcgatgccggctgtggcagc
gggcgctacatgctgcaggcgctgcaacgcggcgctgcgcaggtcactggcgtagacctc
tcgccggaaatgctgcaacgcgccgcgcacgaactggcgcaacgctggcccgccacgtgc
ttctccctgcagcagggcagcctggaacagttgccggttgccgatgccatggccgacatc
accgtgtgcggcctggtggtcgggcatctgccacggctgtggacggcgctggagcaactg
cggcgcgtcacccgcatcggcggcagcgtgctgtgcagcgacgtgcatccgatcggtcat
gcgctgggctggcgacgcgacttcaaggccgacggccagcactacgccatccgccatacc
caacatctctacagccattggcattcggcatgcgcggcgctggatctggcgatcgaggcg
gtggccgagccgatgctcgatcctgccgacatcccgcccggcgcgcgcttcgacaccgcc
gcgctgcaagtgccggtggcgctggtgctacgcctgcgacggctcgcgtga

DBGET integrated database retrieval system