KEGG   Xanthomonas campestris pv. campestris 8004: XC_2564Help
Entry
XC_2564           CDS       T00247                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XC_2564
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XC_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3098863..3099234
Genome map
AA seq 123 aa AA seqDB search
MCAPLAGLLLAGATLAPPARAADGAGKDTFMAECAECHSATQGKNKKGPSMFGIGNRQAA
SLPDYSNYSDALKNSKWQWTPAQLKTYLSQSSSKALPGTKMKYEGLDDPKELDALIVYLN
SLK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgccccgctcgccggcctgctattggccggcgccaccctggcaccgccggcgcgt
gccgccgacggtgcgggcaaggacaccttcatggccgaatgcgccgaatgccacagcgca
acgcaaggcaagaacaagaaaggcccgtccatgttcggcattggcaaccgccaggcggcc
agcctgccggactacagcaactactccgacgcgctcaagaacagcaagtggcagtggacg
ccggcacagctgaagacctacctgtcgcagtcttcgtccaaggcgctgcccggcaccaag
atgaagtacgaaggcctggatgatcccaaggagttggacgcactcatcgtctatctcaac
agcctcaaatga

DBGET integrated database retrieval system