KEGG   Xanthomonas campestris pv. campestris 8004: XC_2564Help
Entry
XC_2564           CDS       T00247                                 

Definition
(GenBank) cytochrome C2
  KO
K08738  cytochrome c
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XC_2564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AAY49614
UniProt: A0A0H2X8L9
Position
3098890..3099234
Genome map
AA seq 114 aa AA seqDB search
MAGATLAPPARAADGAGKDTFMAECAECHSATQGKNKKGPSMFGIGNRQAASLPDYSNYS
DALKNSKWQWTPAQLKTYLSQSSSKALPGTKMKYEGLDDPKELDALIVYLNSLK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
ttggccggcgccaccctggcaccgccggcgcgtgccgccgacggtgcgggcaaggacacc
ttcatggccgaatgcgccgaatgccacagcgcaacgcaaggcaagaacaagaaaggcccg
tccatgttcggcattggcaaccgccaggcggccagcctgccggactacagcaactactcc
gacgcgctcaagaacagcaagtggcagtggacgccggcacagctgaagacctacctgtcg
cagtcttcgtccaaggcgctgcccggcaccaagatgaagtacgaaggcctggatgatccc
aaggagttggacgcactcatcgtctatctcaacagcctcaaatga

DBGET integrated database retrieval system