KEGG   Xanthomonas campestris pv. campestris 8004: XC_2735Help
Entry
XC_2735           CDS       T00247                                 

Definition
ABC transporter vitamin B12 uptake permease
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xcb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xcb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3286862..3287419)
Genome map
AA seq 185 aa AA seqDB search
MSLNRLLVLVFAGLFSTAAVAAGTSVLDLDYRPLAGKAPINLNRSYGGKVVMVVNTASKC
GFTPQYEGLEALNQRFGSRGFTVLGFPSNDFQGQEPGSEKQIQEFCTLTYGVKFPMFEKV
HVLGAQATPLYQRLTRETGVAPGWNFHKYLIGRNGHVVAQFPSKVKPDDPQVLAAIEREL
KAPAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcaatcgtctgttggtccttgtatttgctggacttttttccactgctgcggtg
gcagccggtacctcggtgctggatctggactatcgcccgctggccggcaaggccccaatc
aacctgaaccgtagttacggcggcaaggtggtgatggtggtcaacaccgccagcaagtgc
ggcttcaccccgcagtacgaaggcctggaagcgctcaatcagcgcttcggcagccgcggg
ttcacggtgctcggcttcccgtccaacgatttccaggggcaggaacccggatctgagaaa
cagatccaggaattctgcacgctgacctatggcgtcaagttcccgatgtttgagaaggtg
catgtgctgggcgcgcaggcgaccccgctgtatcagcgactgacgcgcgagaccggcgtg
gcgccgggttggaacttccacaagtatttgatcggtcgcaatggacatgtggtggcgcag
ttcccgagcaaggtcaagccggacgatccgcaggtgctggcggcgatcgagcgcgagctc
aaggcgccagcacgctga

DBGET integrated database retrieval system