KEGG   Xanthomonas campestris pv. campestris 8004: XC_2750Help
Entry
XC_2750           CDS       T00247                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XC_2750
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XC_2750
  Amino acid metabolism
   00310 Lysine degradation
    XC_2750
Enzymes [BR:xcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XC_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3303652..3304866
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPAEEKKADATAAAAAPAAAPAPAAAAAAAPVASKS
SADSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVAM
TRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKA
AANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERQSFAEVEQGIAD
YAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggtgaagcggtcaagcgcgacgagaatctggtcgatctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagatcctggcgatcatcgaagaaggcgcc
gtggccgcagctgcaccggccgaagagaagaaggccgatgccacggcggccgccgctgcg
cctgctgctgcgccggcaccggctgccgctgccgctgccgcgccggttgcatcgaagtcg
tctgctgacagcctgccgccgggtgcgcgtttttccgccatcacccagggcgtggatccg
tcgcaggtcgacggcaccggccgtcgtggcgcggtgaccaaggaagatatcgtcaacttc
gccaaggccggcggcgtgggcaaggcgtctggcgcccgtcctgaagagcgcgtggcgatg
acccgcgtgcgcaagacgatcgccaagcgcctgatggagtccaagaactccaccgcgatg
ctgaccaccttcaacgaggtcaacctcgccaaggtgtcggccgcgcgcaaggaactgcag
gacgaattccagaaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggcc
gcggccaacgcactgcagcgcttcccactggtcaacgcctcgatcgacggcgacgacatc
atctatcacggctacagcgacatctcgatcgccgtctccaccgagaagggcctggtgacg
ccggtgctgcgtaacgtcgagcgccagtcatttgccgaagtcgaacagggcatcgccgac
tacgccgccaaggcgcgcgccggcaagctgggcctggacgacctgcagggtggcaccttc
accatcaccaatggcggcaccttcggctcgctgttgtcgaccccgatcatcaacccgccg
cagagcgccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccag
gtcgtgatcgcgccgatgatgtacctggcgctgtcctacgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccggatg
ctgtttggcctctaa

DBGET integrated database retrieval system