KEGG   Xanthomonas campestris pv. campestris 8004: XC_2750Help
Entry
XC_2750           CDS       T00247                                 

Definition
(GenBank) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00020  Citrate cycle (TCA cycle)
xcb00310  Lysine degradation
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
Module
xcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XC_2750
  Amino acid metabolism
   00310 Lysine degradation
    XC_2750
Enzymes [BR:xcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XC_2750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H SAPS
Motif
Other DBs
NCBI-ProteinID: AAY49799
UniProt: A0A0H2XAM9
Position
3303652..3304866
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGEAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FEAGSTVTSNQILAIIEEGAVAAAAPAEEKKADATAAAAAPAAAPAPAAAAAAAPVASKS
SADSLPPGARFSAITQGVDPSQVDGTGRRGAVTKEDIVNFAKAGGVGKASGARPEERVAM
TRVRKTIAKRLMESKNSTAMLTTFNEVNLAKVSAARKELQDEFQKAHGIKLGFMSFFVKA
AANALQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERQSFAEVEQGIAD
YAAKARAGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtttccgacgccaccatcgcc
agctggcacaagaaggccggtgaagcggtcaagcgcgacgagaatctggtcgatctggaa
accgacaaggtcgtgttggaagttccttcgccggtcgacggcgtactgaaggaaatcaag
ttcgaagccggcagcacggtcaccagcaaccagatcctggcgatcatcgaagaaggcgcc
gtggccgcagctgcaccggccgaagagaagaaggccgatgccacggcggccgccgctgcg
cctgctgctgcgccggcaccggctgccgctgccgctgccgcgccggttgcatcgaagtcg
tctgctgacagcctgccgccgggtgcgcgtttttccgccatcacccagggcgtggatccg
tcgcaggtcgacggcaccggccgtcgtggcgcggtgaccaaggaagatatcgtcaacttc
gccaaggccggcggcgtgggcaaggcgtctggcgcccgtcctgaagagcgcgtggcgatg
acccgcgtgcgcaagacgatcgccaagcgcctgatggagtccaagaactccaccgcgatg
ctgaccaccttcaacgaggtcaacctcgccaaggtgtcggccgcgcgcaaggaactgcag
gacgaattccagaaggcgcacggcatcaagctcggtttcatgagcttcttcgtcaaggcc
gcggccaacgcactgcagcgcttcccactggtcaacgcctcgatcgacggcgacgacatc
atctatcacggctacagcgacatctcgatcgccgtctccaccgagaagggcctggtgacg
ccggtgctgcgtaacgtcgagcgccagtcatttgccgaagtcgaacagggcatcgccgac
tacgccgccaaggcgcgcgccggcaagctgggcctggacgacctgcagggtggcaccttc
accatcaccaatggcggcaccttcggctcgctgttgtcgaccccgatcatcaacccgccg
cagagcgccatcctgggcatgcacgcgatcaaggaacgtccgatcgccgagaacggccag
gtcgtgatcgcgccgatgatgtacctggcgctgtcctacgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtcgacatcaagaatcagctggaaaacccgggccggatg
ctgtttggcctctaa

DBGET integrated database retrieval system