KEGG   Xanthomonas campestris pv. campestris 8004: XC_2818Help
Entry
XC_2818           CDS       T00247                                 

Definition
phospholipase
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    XC_2818
   00565 Ether lipid metabolism
    XC_2818
   00590 Arachidonic acid metabolism
    XC_2818
   00591 Linoleic acid metabolism
    XC_2818
   00592 alpha-Linolenic acid metabolism
    XC_2818
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     XC_2818
    3.1.1.32  phospholipase A1
     XC_2818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3388226..3389356
Genome map
AA seq 376 aa AA seqDB search
MSKQRARPLMLIALAAAPLAHAQEIAPQPASPQACTSVTSDAARLACYDQALGYTPQAVQ
EADAAAQLAKQAAKSEDTRKISRVGDFFRADGQDQPKEEAVANAGRGSLLDRRWELAKDS
KLGTFQLRGYKPVYLLPAFWTSDTNRTPQSPNPANSVSTPQQLDSAELKFQLSFKTKVVE
DLFGDNGDIWMGYTQSSRWQAYNSDASRPFRETNYEPEAMLVFRNNYSIFGWKGRMSGIS
INHMSNGREDPLSRSWNRVILNIGLDRENWALTLRPWFRIKEDRADDNNPDIEDYMGRGD
ATLVYNKDGHEFALIARHSLRGGDRSHGSVQLDYGFPITNLLRGHVQVFDGYGESLIDYN
HKATYVGVGVSLLEWF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaacgtgcccgtcccctaatgctgatcgccctggccgctgcgccgctggcg
cacgcgcaggaaatcgctccacagccagcatcgccgcaggcctgtacctccgtgacttcg
gatgccgcgcgtctggcgtgctacgaccaggcgctgggatataccccgcaggccgtgcag
gaggcagatgccgccgcgcagttggccaagcaggccgccaaatcggaagacacccgcaag
atcagccgcgtgggcgatttcttccgcgccgacggccaggaccagccgaaggaagaagcg
gtcgccaatgccggccgcggctcgctgctggatcgccgctgggagctggccaaggattcc
aagctggggaccttccagctgcgcggctacaagccggtctatctgttgccggcattctgg
accagcgacaccaaccgcacgccgcagtcgccgaacccggccaactcggtcagcacgccg
cagcaactggacagcgccgagctgaagttccagctgagcttcaagaccaaggtggttgag
gatctgttcggcgacaacggcgatatctggatgggctatacccagagctcgcgctggcag
gcctataactccgatgcctcgcgcccgttccgcgagaccaattacgagccggaagcgatg
ctggtgtttcgcaacaactacagcatcttcggctggaaaggccgcatgagcggcatcagc
atcaatcacatgtccaacggccgcgaagacccgctgtcgcgttcctggaaccgggtgatc
ctcaatatcggcctggatcgcgaaaactgggcgctgacgttgcgcccgtggttccgtatc
aaggaagaccgtgccgacgacaataatccggacatcgaggattacatgggccgcggcgac
gccaccctcgtctataacaaggatggccacgaattcgccttgattgcccggcattcgctg
cgtggcggcgaccgctcgcacggctcggtgcaactggattacggcttcccgatcaccaac
ctgttgcgcggccacgtgcaggtgttcgacggctatggcgagagcctgatcgactacaac
cacaaggccacctatgtgggcgtgggcgtgtcgttgctggaatggttctga

DBGET integrated database retrieval system