KEGG   Xanthomonas campestris pv. campestris 8004: XC_2985Help
Entry
XC_2985           CDS       T00247                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xcb00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:xcb00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:xcb00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3575073..3577853
Genome map
AA seq 926 aa AA seqDB search
MDQQQLQNTLGHRLVVGERQLLRFPAQQRSAAGDRLHAPSVYRRACIASLRSRQACYRHA
RRRCRQQEGAAMTGINRRELLRGMLASGVRAALPAGAAGALLPGSADAAPAAAKDATPLA
PLGDASLAPRERLLFDFGWRFHPGHASDPSRDFEFGTFQRTFAKAGKDTATAAQLAFDDS
NWQQVDLPHDWAVTLPFRPEPISASMTEEDPAAAHGYKALGTSFPENSVGWYRRMLQIPA
SDLGKRICLVFDGVFRDCVVFCNGHIVGRNASGYCGFEVDLSEVLDYGKPNLIVVRVDAT
LGEGWFYEGAGIYRHLWLQKTDPLHVPQHGVFVRSSVQGDTATAQLSTEVRNDGTASRQC
VVQARITAPYGRIVAQAASAAVTVAPGQVQVVEQTVPLGQAALWSIDTPQLYTLTTSVHS
AGVAVDALVTPFGVRSIAFDAQRGFLLNGAPLKLHGTNNHQDHAGVGTAIPDALHAWRLR
QLKSMGCNAYRSSHNPATPELLALCDRLGMFVIEETRRMSTDPEAMAELETMVRRGRNHP
SVILWSLGNEEPQQVTERGARIVTRMQQRVRQLDPTRPTTFAMDKGFGDGVGQVVDVVGF
NYRTSQMDGFHAQYPNIPIYGSETGSTVSVRGNYQRDDTRGYTRAYDTDHPWWASTAEAW
WSYVAQRPYIAGGFIWTGFDYRGEPTPYNRWPNVGSQFGVLDSCGFPKDNYWYYRAQWTS
EPVLHLFPHWNWDGLLQPDDKGRVEVWCHSNLEAVELLVNGVSQGLQQVPAYGHVEWRVA
YAPGVIEARGYRGGKLVLTERRETVGKPAAIRLSCDRSALRADAEDVAVVKVEIVDAQGR
LVPNADHLVHLVLRGPARLIGVGNGDPSSHEDDKAPQRKAFNGLCMALLRSTRSSGQILL
QATAPGLTSAALHLQAATSALRPSVD
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcagcagctgcaaaacacgctggggcaccggctcgtcgtgggagaacgccag
cttcttcgatttccagcacaacaacgaagtgctgccggcgatcgacttcatgcgccatcc
gtataccggcgtgcctgcatcgcatcgctccgaagcaggcaagcctgctatcgacacgca
aggcgacgctgccgacaacaagagggcgcagccatgaccggcatcaatcgccgcgaatta
ctgcgcggcatgttggcaagtggcgtgcgtgccgcactcccggccggtgcagccggtgcg
ctgttgcccggcagtgcggatgcagcgccagccgcggcgaaagatgccacgccgctcgcc
ccgctcggcgatgcaagcctggcaccacgcgaacggctgctgttcgacttcggttggcgg
ttccatcccggccatgccagcgacccatcgcgcgacttcgagttcggcaccttccagcgc
accttcgccaaggccggcaaggacaccgccaccgccgcgcaactggccttcgacgacagc
aactggcaacaggtggacctgccgcacgactgggccgtgaccctgcccttccgtccggag
ccgatctccgcctcgatgaccgaagaagacccggcggccgcgcacggctacaaggcgctg
ggcacgagctttccggaaaacagcgtgggctggtatcggcgcatgctgcagatcccggcc
agcgatctgggcaagcgcatctgcctggtgttcgacggcgtgttccgcgattgcgtggtg
ttttgcaacggccacatcgtcgggcgcaacgccagcggctattgcggcttcgaggtcgac
ctgagcgaagtgctcgactacggcaagcccaacctcatcgtcgtgcgcgtggatgccacg
ctcggcgaaggctggttctatgaaggcgccggcatctaccggcatctgtggctgcagaag
accgacccgctgcacgtgccgcagcatggcgtgtttgtgcgcagcagcgtgcaaggcgac
accgccaccgcgcagctttccaccgaagtgcgcaacgacggcaccgcgtcacgccagtgc
gtggtgcaggcccgcatcaccgcaccgtatggacgcatcgtggcgcaagcggccagcgca
gcggtcacggttgcgcccggtcaggtacaggtcgtcgaacagaccgtgccgctcggccag
gccgcgttgtggtcgatcgacaccccgcagctctacaccctcaccaccagcgtgcacagc
gcaggggttgcggtcgatgcgcttgtcacaccgttcggcgtgcgcagcatcgctttcgat
gcgcaacgcggctttctattgaatggtgccccgttgaaattgcacggcaccaataatcac
caggaccatgccggcgttggcacggccattcccgatgccttgcacgcatggcgcctgcgc
cagctcaagtcgatgggctgcaacgcgtatcgcagctcgcacaatccggccacccccgaa
ctgctcgcgctgtgcgaccgcctgggcatgttcgtgatcgaagaaacccggcgcatgtcc
accgacccggaggcaatggccgaactggagacaatggtccggcgcgggcgcaaccacccc
agcgtgatcctgtggtcgctcggcaacgaagagccgcaacaggtcaccgaacgcggcgcg
cgcatcgtcacgcgcatgcagcaacgcgtgcgccagctcgaccccacccgccctactacg
ttcgccatggacaagggctttggcgacggcgtgggccaggtggtggatgtggtcggcttc
aactaccgcaccagccagatggacggcttccacgcgcaatatcccaatattccgatctac
ggcagcgaaaccggcagcaccgtctcggtgcgcggcaactaccagcgcgacgatacccgc
ggctacacccgcgcctacgacaccgaccacccgtggtgggccagcactgccgaagcctgg
tggagctacgtcgcgcaacgcccgtacatcgccggcggctttatctggaccggtttcgat
taccgcggcgaacccacaccctacaaccgctggccgaatgtcggctcgcaattcggcgta
ttggatagttgcggctttcccaaggacaactactggtactaccgcgcgcagtggaccagc
gagccagtgctgcatctgttcccgcactggaactgggacggtctgctgcagcccgatgac
aaaggccgcgtcgaggtctggtgtcacagcaatctcgaagcggtggaactactggtcaac
ggcgtcagccagggcctgcagcaggtgcctgcctacggccatgtcgaatggcgcgtggca
tacgcaccgggcgtgatcgaagcgcgcggctatcgcggcggcaaactggtgctcaccgaa
cgccgtgaaaccgtcggcaagccggcagcgatccgcctgagttgcgatcgcagcgcactg
cgcgccgatgccgaagatgtggcggtggtgaaagtggagatcgtcgatgcgcaaggccgg
cttgtaccgaatgccgaccacctggtgcacctcgtcctgcgtggacctgcacgtctgatc
ggcgtgggcaacggcgaccccagcagccacgaagacgacaaggcgccgcagcgcaaggca
tttaacggcttgtgtatggcgttgctgcgaagcacgcgcagcagcggccagatcctgctg
caggccaccgcgccaggcctgacctcggcagcgctgcatctgcaggctgccacgtcggcc
ttgcggccgtcggtcgactga

DBGET integrated database retrieval system