KEGG   Xanthomonas campestris pv. campestris 8004: XC_3468Help
Entry
XC_3468           CDS       T00247                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XC_3468
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XC_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4118260..4119216
Genome map
AA seq 318 aa AA seqDB search
MSSVVVVGSFNVDHVWRCDALPAPGATIAGRYSTGPGGKGFNQAVAAARAGAKTHFLCAL
GDDAGGALARSLAAQDGFALIAEPSNEPTGTGGIYVDAHGRNTIVIGAGANSVLSAGFVD
NQRALVTSARVLLAQLESPAETVESALALARECGVLTVLNAAPANAPTSISLLKLSDVLT
PNETEFAALLGRHVGERINADDVAALDGNTLHSLCRKLLPGGTVVVTLGAVGAFISHAEE
QLRGDTQAHYRVGAESAQTVDTTGAGDAFNGALVASLAHSPNASFITHVRFATRYAARST
EVEGAATSMPRMVPEPAV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggtcgtcgttgtcgggtccttcaatgtcgatcacgtgtggcgctgtgatgcc
ctgcccgcgccgggcgccaccatcgccggtcgctacagcactggtcccggcggcaagggg
ttcaaccaggccgttgcagccgcacgtgccggcgccaagacgcacttcctgtgcgcgctg
ggcgacgatgccggcggtgcactggcgcgttcgctggccgcgcaagacgggtttgcgctg
atcgccgagcccagcaatgagcccaccggcaccggcggcatctatgtcgacgcgcatggc
cgcaacaccatcgtgatcggtgccggcgccaattcggtgctgagcgccgggtttgtcgac
aaccagcgcgcgctggtgacctcggcgcgcgtgctgctggcgcagctggaatcgccggcc
gaaacggtggaatcggcgctggcgctggcacgcgaatgcggtgtgctcaccgtgctcaac
gccgcgccggccaacgcgccgacctcgatcagcctgctcaagctctccgacgtattgacg
ccgaacgaaaccgagtttgctgcgctgctcggccgccacgttggcgagcgcatcaacgcc
gacgatgtggcggcgctggacggcaatacgctgcattcgctgtgccgcaagctgctgccg
ggcggcaccgtggtggtgacgctgggtgcggtgggcgccttcatttcgcacgccgaagaa
cagctgcgcggcgacacccaggcgcattaccgcgtgggcgcggaaagcgcgcagacggtg
gataccaccggtgctggcgatgccttcaacggcgcgctggtggcttcgctggcgcactcg
cccaatgcaagcttcatcacccacgtgcgctttgccacgcgctacgccgcacgctccacc
gaagtggaaggcgcggcgacctcaatgccgcgcatggtgcccgaaccggcggtgtga

DBGET integrated database retrieval system