KEGG   Xanthomonas campestris pv. campestris 8004: XC_3586Help
Entry
XC_3586           CDS       T00247                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XC_3586
   00240 Pyrimidine metabolism
    XC_3586
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XC_3586
   03430 Mismatch repair
    XC_3586
   03440 Homologous recombination
    XC_3586
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XC_3586
DNA replication proteins [BR:xcb03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XC_3586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4263529..4263954
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLDEPLRLVCELARKANDANLSTLILARDAAQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIATPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttttacctgatcgccaaaccgcgcttcctcgacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgatgccaacctgtccacgctgatcctggcg
cgcgatgccgcacaggccgaggcgctggatgacctgttgtgggcgttcgacgacgaagcc
tatgtgccgcaccagatcgccggcaccgatgaggaagacgaactggcgccggtgctgatc
gcaacgcccgagttcgccgcgccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtggtgcccgccgaccccgccgcccgcgaa
ccgctgcgcgaacgctggaagcagtacaaggccctgggcctggaactcacgaaatacgac
atgtag

DBGET integrated database retrieval system