KEGG   Xanthomonas campestris pv. campestris 8004: XC_3608Help
Entry
XC_3608           CDS       T00247                                 

Definition
(GenBank) phosphoglucomutase; phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00030  Pentose phosphate pathway
xcb00051  Fructose and mannose metabolism
xcb00052  Galactose metabolism
xcb00230  Purine metabolism
xcb00500  Starch and sucrose metabolism
xcb00520  Amino sugar and nucleotide sugar metabolism
xcb00521  Streptomycin biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_3608
   00030 Pentose phosphate pathway
    XC_3608
   00051 Fructose and mannose metabolism
    XC_3608
   00052 Galactose metabolism
    XC_3608
   00500 Starch and sucrose metabolism
    XC_3608
   00520 Amino sugar and nucleotide sugar metabolism
    XC_3608
  Nucleotide metabolism
   00230 Purine metabolism
    XC_3608
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XC_3608
Enzymes [BR:xcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XC_3608
    5.4.2.8  phosphomannomutase
     XC_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAY50650
UniProt: A0A0H2XCS6
Position
4289023..4290375
Genome map
AA seq 450 aa AA seqDB search
MPMTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALS
AGLRASGREVIDIGLCGTEEVYFQTDHLKAAGGVMVTASHNPMDYNGMKLVREQARPISS
DTGLFAIRDTVAADTAAAGEPTAAEHSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGG
AGLIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKEHGADFGIAWDG
DFDRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEMVEDAGGIPVL
CKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLV
EARMQKFPCSGEINFKVDDAKAAVARVMAHYGDQSPELDYTDGISADFGQWRFNLRSSNT
EPLLRLNVETRGDAALLETRTQEISNLLRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgacgctacccgccttcaaggcctacgatattcgcggccgcgtgccggatgaa
ctcaacgaggacttggcccgccgcatcggcgtggcactggcggcgcagctggatcaaggg
cccgtggtcctgggccacgatgtgcgcctggcgagcccggcactgcaggaagccctgtct
gccggcctgcgtgccagcggccgcgaggtgatcgacattggcctgtgtggcaccgaggag
gtctatttccagaccgatcacctcaaggccgccggcggcgtgatggtcaccgccagccac
aacccgatggactacaacggcatgaagctggtgcgtgagcaggcgcggccgatcagctcc
gataccggcctgttcgccatccgcgacacggtcgcggccgacactgccgctgcaggcgag
cccaccgctgccgagcacagccgcaccgacaagaccgcgtatctggagcacctgctcagc
tacgtagaccgcagcacgctcaagccgctcaagctggtggtcaacgccggcaacggcggc
gccggcctgatcgtcgacctgctggcaccgcatctgccattcgaattcgtgcgcgtcttc
cacgagcccgatggcaacttccccaacggcatccccaacccgctgctgccggaaaaccgc
gacgccaccgccaaggcggtcaaggaacacggcgccgacttcgggattgcctgggatggc
gacttcgatcgttgcttcttcttcgatcacactggccgcttcatcgagggctattacctg
gtcggcctgctggcgcaagccatcctggccaagcagcccggcggcaaggtcgtgcacgac
ccgcgcctgacctggaacacggtggagatggtggaagacgccggcggcattccggtgctg
tgcaagagtggccacgccttcatcaaggaaaagatgcgcagcgaaaatgccgtctatggt
ggcgaaatgagcgcgcaccattacttccgcgaattcgcctacgccgactcgggcatgatt
ccgtggctgctgatcgccgagctggtctcgcaatcgggccgttcgctggcggacctggtc
gaagcgcgcatgcagaagttcccctgcagcggcgagatcaatttcaaggtcgacgacgcg
aaggccgcggttgcacgcgtcatggcgcattacggtgatcagtcaccggagctggattac
accgacggcatcagcgccgacttcgggcaatggcgcttcaacctgcgcagctccaacacc
gagccgctgctgcgtctgaacgtggaaacgcgcggcgatgctgcactgctggagacgcgt
acgcaggaaatttccaacctgttacgcggctga

DBGET integrated database retrieval system