KEGG   Xanthomonas campestris pv. campestris 8004: XC_3691Help
Entry
XC_3691           CDS       T00247                                 

Definition
(GenBank) dihydrolipoamide acetyltranferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00020  Citrate cycle (TCA cycle)
xcb00620  Pyruvate metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
Module
xcb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_3691
   00020 Citrate cycle (TCA cycle)
    XC_3691
   00620 Pyruvate metabolism
    XC_3691
Enzymes [BR:xcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XC_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: AAY50731
UniProt: A0A0H2XB27
Position
complement(4377892..4379649)
Genome map
AA seq 585 aa AA seqDB search
MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKATMEVPSSVAGVVKEI
KVKVGDSLSQGALVALIEVADADAGAETAAAPAPAAAPAKAAPAAAPAPAAKAAPAAASD
GGQVEARVPDIGDYSGVPVIEVLVAVGDTVAKDQSLVTLESDKATMEVPSSVAGVIKELK
VKVGDSLSQGDLVAIIAASDGGAGAAQSPAKPTTDTAETAGKVEPVAVPAEPDKLAQREI
AQVQSARSTAASQPAQAAPGTPSSPPVTFDADSVLPSKVPYASPVVRVFARELGVDLNQI
KGSEKGGRITREDVQRFVKAALSGGAPAAAGAAPAGGGNGLNLLAWPKVDFSKFGETETQ
PLSRIKKISGANLARNWAMIPHVTQFESADITDLEALRVALNKENEKAGIKLTMLAFLIK
ASAAALKKFPEFNASLDAAGENLTLKKYINIGFAADTPNGLVVPVIRDVDKKGVLQIAQE
SGELAKKARDGKLGPADMSGGCFSISSLGGIGGTAFTPIINAPEVAILGVSKSAMQPVWN
GKDFAPKLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaggaagcacttgtccccgatatcggtgactacagcgatgtcccggtg
atcgaagtgctggtgtcggtcggcgatacggtcagcaaggaccagagcctggtcacgctg
gaatcggacaaggccacgatggaagtcccctcgtcggtggccggcgtggtcaaggagatc
aaggtcaaggtcggtgacagcctgtcgcagggcgcgctggtcgcgctgatcgaagtagcc
gatgccgatgccggtgccgagacggctgcggcgccagcgcctgccgctgcgcccgccaag
gccgcacctgctgccgctcctgcgccggctgccaaggccgcgcctgccgcagcgtccgac
ggcggtcaggtcgaggcccgtgtgccggacatcggcgactacagcggcgtgccggtgatc
gaagtgctggtggcggtgggcgacaccgtcgccaaggaccagagcctggtcacgctggaa
tcggacaaggccacgatggaagtgccctcgtctgtggccggcgtgatcaaggagctcaag
gtcaaggtcggcgacagcctgtcgcagggcgatctggtggcgatcatcgctgccagcgat
ggcggcgccggtgcggcgcagtccccggccaagcccaccaccgacaccgctgaaaccgcc
ggcaaggtcgagccggtggccgtcccggccgagccggacaagctggcccagcgcgagatc
gcgcaggtgcagtcggcacggtccaccgcggcatcgcagccggcccaggcagcgcccggc
accccgagcagcccgccggtgaccttcgatgccgacagcgtgctgccgtccaaggtgccg
tatgccagcccggtggtgcgcgtgttcgcgcgcgagctcggcgtggatctgaaccagatc
aagggcagcgagaagggcggccggatcacccgtgaagacgtgcagcgcttcgtcaaggcc
gcactcagcggcggcgcgccggccgcagccggtgccgcaccggccggtggtggcaacggc
ctgaacctgctggcctggccgaaggtggacttcagcaagttcggcgaaaccgaaacccag
ccgctgtcgcgcatcaagaagatttccggtgcgaacctggcgcgcaactgggccatgatc
ccgcacgtcacccagttcgaatcggccgacatcaccgacctggaagccctgcgcgtggcg
ctgaacaaggaaaacgaaaaggccggcatcaagctgaccatgctcgccttcctcatcaag
gccagtgccgcggcgctgaagaagttccccgagttcaacgcctcgctcgacgcggccggc
gaaaacctcacgctgaagaagtacatcaacatcggctttgccgctgacaccccgaacggc
ttggtcgtgccggtgatccgcgacgtcgacaagaagggcgtgctgcagatcgcgcaggaa
agtggcgagctggccaagaaggcacgcgacggcaagctgggcccggccgacatgagcggc
ggctgcttctcgatcagctcgctcggtggcattggcggcaccgcgttcacgccgatcatc
aatgcaccggaagtggcgatcctgggcgtgtccaagtcggcgatgcagccggtctggaac
ggcaaggacttcgcaccgaagctgatgctgccattgtcgttgagctacgaccaccgcgtc
atcgacggcgcgctggccgcgcgcttcaccacctatctcagccaggtgctcgccgacatg
cgacgcgtcctgctgtga

DBGET integrated database retrieval system