KEGG   Xanthomonas campestris pv. campestris 8004: XC_3895Help
Entry
XC_3895           CDS       T00247                                 

Definition
disulfide-isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XC_3895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4600387..4601964
Genome map
AA seq 525 aa AA seqDB search
MKLSCRRPRPLSIALLAVLATLTACDKPTPSAHAQASPTAAPAAHAGIAWREGGLEAAFA
EARDSGKPILLYWGAAWCAPCNRLKATLFQDPAFIAQTRHFVAVHLDGDAEGTLDWGERF
GIKGYPTIIVLRSDRSEVTRLAGNSDTARLADVLRVVATSTTTVKQLLDKAQHAPQELSA
DDWAVLGNYGWGMDDSLVKSGELPALLARLSERAPQPSLRRRFALAAIVAPEDPPTPSPA
NRAVLEAILADPAEVRANLSTLNYVPAWLVKAGSTDAGQRASLSAKLDQALDAVYADPGV
PINDRLETAFAKIELARLAQGQPTETAPKEPQPPLPAAVVETVHQRVQTIVAAARTAEEH
QSITDSAAALLSEVGDSSGAEQLLLAEVGRSKTPYYYMPRLSQLAEERGDRKTALSWLKK
NYTTASSPVARAQSGARYADGLIRLSPEDSAAIEAVATQAIGALAAQSDADRQRSRKRFA
RLGSALKTWSKQHQQEGTAVLARLRQKMQASCGGKNTSECTSWLS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcctgccgacgcccgcgcccgctgtcgatcgcactgctggcggtactggca
accctgaccgcctgcgacaagcccacgccgtcggcgcacgcgcaggccagtcccaccgcc
gcgcccgcagcgcacgccggcattgcctggcgcgaaggcgggctcgaagcggcgtttgcc
gaagccagggacagcggcaagccgatcctgctgtactggggcgcggcatggtgcgcgccg
tgcaaccgcctgaaggccaccttgttccaggatccggcgttcatcgcgcagacgcggcac
ttcgtggcagtgcatctggatggcgatgcggaaggcacgctggactggggtgaacgcttc
ggcatcaagggctacccgaccatcatcgtgctgcgttcggaccgcagcgaagtcacccgc
ctggctggcaacagcgacaccgcgcgcctggccgatgtcctgcgggtggtcgccaccagt
accaccaccgtcaaacaactgctggacaaggcgcagcatgccccgcaggaactgagtgcg
gacgactgggccgtcctcggcaactatggctggggcatggacgacagtctggtcaagtcc
ggcgagctgcctgccctgttggcacgcttgtccgaaagagcgccgcaaccgagcttgcgg
cgccgttttgcgctggcggcgatcgtcgcaccggaggacccgcccactcccagtcctgcc
aatcgcgccgtgctggaagcgattctggccgatccggccgaagtgcgagccaatctgagc
acgctgaattacgtgcccgcatggctggtcaaggcgggcagcaccgatgccggccaacgt
gccagcttgtcggccaagctggatcaagcattggacgcggtctatgcagatcccggcgtg
ccgatcaacgaccggctggaaaccgcctttgcgaaaatcgagctcgcgcgcctcgcccag
ggacagccgaccgagaccgcgccgaaggaaccgcaaccaccgctaccggcggcggtcgtg
gagacggtgcatcagcgtgtgcagacgatagtggctgcagccaggaccgccgaggagcat
caatccatcaccgacagcgcagccgcgttgctgagcgaggtgggcgacagcagcggcgcc
gagcaattgctgctggccgaagtcggacgcagcaagaccccgtattactacatgccacgc
ctctcccagctcgccgaagaacgcggcgatcgcaagaccgcgttgtcctggctcaagaag
aactacaccactgccagcagccccgtcgcgcgcgcgcagtcgggcgcgcggtatgcagat
gggctgatccggctcagccccgaggacagtgccgccatcgaagcggtagccacccaggcg
atcggcgcgctggcagcacaatcggatgccgaccgccagcgcagccgtaagcgctttgcc
cggcttgggagcgcgctgaagacctggagcaagcagcatcagcaggaaggcactgcagtg
ctggcgcgattgcggcagaaaatgcaggccagctgcggcggcaagaacaccagcgagtgc
accagctggctgagttga

DBGET integrated database retrieval system