KEGG   Xanthomonas campestris pv. campestris 8004: XC_3901Help
Entry
XC_3901           CDS       T00247                                 

Definition
cytochrome C oxidase subunit III
Orthology
K02276  
cytochrome c oxidase subunit III [EC:1.9.3.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    XC_3901
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     XC_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4605761..4606636)
Genome map
AA seq 291 aa AA seqDB search
MADHSPNADAYFVPTQSKWPFVGSIAMFVMMIGVASWLNDAGWGRWTFFAGVAMLLATLF
MWFGDVIRESNAGHYNRQVDGSFRMGMVWFIFSEVMFFGAFFGALFYTRVLTLPWLGGEG
DGVMTNELLWNGYSAAWPTNGPGTIGGQFQTIPAWGLPLINTLILLSSGVTLTIAHHALK
GGRRRALLLWLGLTVLLGCVFLFLQAEEYIHAYTELNLTLGSGIYGSTFFMLTGFHGMHV
LLGTIMLAVMWLRAAKGHFSRDNHFAFEAAAWYWHFVDVVWLALFLFVYVL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccacagtcccaacgccgacgcgtatttcgtcccgacccaaagcaagtggccc
tttgtcggctccattgcgatgttcgtgatgatgatcggcgtggccagctggctcaacgac
gccggatgggggcgctggacgttcttcgccggtgtggccatgttgctggcgacgttgttc
atgtggtttggcgacgtgattcgcgagtcgaacgccggccactacaaccgccaggtggac
ggctcgttccgcatgggcatggtgtggtttattttttccgaggtgatgttcttcggcgcc
ttcttcggtgcgctgttctacacgcgcgtgctgacactgccctggctgggcggcgagggc
gatggcgtgatgaccaacgaactgctgtggaatgggtattccgcagcctggccgaccaat
ggcccgggcaccatcggcgggcagttccagaccattccggcctggggcttgccgctgatc
aacacgctgatcctgctcagctccggcgtgaccttgaccattgcccatcacgcattgaaa
ggcggccgacgccgcgcgctgttgctgtggttggggctgaccgtgctgttgggctgcgtg
ttcctgttcctgcaggcggaggaatacatccacgcctacacagaactcaatctcacattg
ggctcgggcatctacggctcgaccttcttcatgctcaccggcttccacggcatgcatgtg
ctgctgggcacgatcatgctggcggtgatgtggctgcgcgccgcaaagggccacttcagc
cgcgacaatcatttcgccttcgaagccgccgcctggtactggcacttcgtcgacgtggtg
tggctggcgctgttcctgtttgtgtatgtgctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system