KEGG   Xanthomonas campestris pv. campestris 8004: XC_3901Help
Entry
XC_3901           CDS       T00247                                 

Definition
cytochrome C oxidase subunit III
Orthology
K02276  
cytochrome c oxidase subunit III [EC:1.9.3.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:xcb00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4605761..4606636)
Genome map
AA seq 291 aa AA seqDB search
MADHSPNADAYFVPTQSKWPFVGSIAMFVMMIGVASWLNDAGWGRWTFFAGVAMLLATLF
MWFGDVIRESNAGHYNRQVDGSFRMGMVWFIFSEVMFFGAFFGALFYTRVLTLPWLGGEG
DGVMTNELLWNGYSAAWPTNGPGTIGGQFQTIPAWGLPLINTLILLSSGVTLTIAHHALK
GGRRRALLLWLGLTVLLGCVFLFLQAEEYIHAYTELNLTLGSGIYGSTFFMLTGFHGMHV
LLGTIMLAVMWLRAAKGHFSRDNHFAFEAAAWYWHFVDVVWLALFLFVYVL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccacagtcccaacgccgacgcgtatttcgtcccgacccaaagcaagtggccc
tttgtcggctccattgcgatgttcgtgatgatgatcggcgtggccagctggctcaacgac
gccggatgggggcgctggacgttcttcgccggtgtggccatgttgctggcgacgttgttc
atgtggtttggcgacgtgattcgcgagtcgaacgccggccactacaaccgccaggtggac
ggctcgttccgcatgggcatggtgtggtttattttttccgaggtgatgttcttcggcgcc
ttcttcggtgcgctgttctacacgcgcgtgctgacactgccctggctgggcggcgagggc
gatggcgtgatgaccaacgaactgctgtggaatgggtattccgcagcctggccgaccaat
ggcccgggcaccatcggcgggcagttccagaccattccggcctggggcttgccgctgatc
aacacgctgatcctgctcagctccggcgtgaccttgaccattgcccatcacgcattgaaa
ggcggccgacgccgcgcgctgttgctgtggttggggctgaccgtgctgttgggctgcgtg
ttcctgttcctgcaggcggaggaatacatccacgcctacacagaactcaatctcacattg
ggctcgggcatctacggctcgaccttcttcatgctcaccggcttccacggcatgcatgtg
ctgctgggcacgatcatgctggcggtgatgtggctgcgcgccgcaaagggccacttcagc
cgcgacaatcatttcgccttcgaagccgccgcctggtactggcacttcgtcgacgtggtg
tggctggcgctgttcctgtttgtgtatgtgctttga

DBGET integrated database retrieval system