KEGG   Xanthomonas campestris pv. campestris 8004: XC_3941Help
Entry
XC_3941           CDS       T00247                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_3941
   00030 Pentose phosphate pathway
    XC_3941
   00051 Fructose and mannose metabolism
    XC_3941
   00052 Galactose metabolism
    XC_3941
   00500 Starch and sucrose metabolism
    XC_3941
   00520 Amino sugar and nucleotide sugar metabolism
    XC_3941
  Nucleotide metabolism
   00230 Purine metabolism
    XC_3941
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XC_3941
Enzymes [BR:xcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XC_3941
    5.4.2.8  phosphomannomutase
     XC_3941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4652882..4654276)
Genome map
AA seq 464 aa AA seqDB search
MQVAAEMFRAYDIRGVVGKDLNPGIAALIGQAIGSVMQAQGLRDIVVGRDGRLSGPELTN
GLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHNPPDYNGFKIVIGGETL
SGAAITELHQRITEGRLHTAASPGELEQRDISDAYIQRIADDVQLDRPIKVVVDAGNGAA
GEIAPRLLEAIGAEVVPLYCEIDGTFPNHHPDPSEPHNLGDLVQMVQRFDADIGVAFDGD
ADRLGVVTKEGAIVFPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGGSPLMW
KTGHSLIKAKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAARLLEILAQREETPSDVL
GELPESVSTPEIKVPLDGDAHALVARFVERAQAGEESPFEAARLSTIDGLRADFGDGWGL
VRASNTTPILVLRFEADTAVALERIRALFRSELQALLPDHPLAF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcgccgcagaaatgttccgcgcgtacgacatccgtggcgtggtgggcaaggat
ctcaaccccggcatcgccgcgctgatcggccaggccatcggcagcgtgatgcaggcgcaa
ggcctgcgcgacatcgtggttggccgcgatggccgtttgtctggcccggaattgaccaac
ggcctgatcgaaggcctgcgccgcgccggttgcaacgtcaccgacatcggcctggcgccg
acgccggtggtgtacttcggcgcctacgaattgcgcgccggcagctgcgtggcggtgacc
ggcagccacaatccgcccgactacaacggcttcaagatcgtgatcggcggcgagacgctc
tccggtgcagcgatcaccgagctgcaccagcgcatcaccgaaggccgcctgcataccgca
gccagccccggcgaactggagcagcgcgacatcagcgatgcctacatccagcgcattgcc
gacgacgtgcagctggaccgcccgatcaaggtggtggtggacgccggtaatggcgcggcc
ggcgagatcgcgccgcgcttgttggaggccatcggtgcggaagtggtgccgctgtattgc
gaaatcgacggcacttttcccaatcaccatccagacccgagcgagccgcacaatctcggc
gatctggtgcagatggtgcagcgcttcgatgcggatatcggcgtggccttcgatggcgat
gccgaccgcctgggcgtggtcaccaaggaaggcgccatcgtcttccccgaccgcctgctg
atgctgtttgccgccgatgtgctgcaacgcaatcccggcgcgctggtgatctacgacgtg
aagtgcaccggcaagctgtccgactacgtgttgcgcaatggcggcagcccgttgatgtgg
aagaccgggcattcgctgatcaaggcgaagatgcgcgaaaccgatgccgagctggccggt
gaaatgagcgggcacttcttcttcaaggagcgctggtacggcttcgacgatggcatctat
gccgccgcgcgcctgctggaaatcctcgcccagcgcgaagagaccccgtccgacgtgctc
ggcgagctgcccgaaagcgtgtccacgccggagatcaaggtaccgttggacggcgatgcg
catgcgctggtggcccggttcgtggagcgtgcccaggccggcgaggagtcgccgttcgag
gccgcgcggttgtccaccatcgatgggctgcgcgcggatttcggcgacggctggggcctg
gtacgtgcgtccaacaccaccccgatcctggtgctgcgcttcgaagccgacaccgctgtg
gcgctggaacgcatccgcgcgctgttccgcagcgaactgcaggcgctgctgccggatcac
ccgctcgcattctga

DBGET integrated database retrieval system