KEGG   Xanthomonas campestris pv. campestris 8004: XC_4191Help
Entry
XC_4191           CDS       T00247                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xcb00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xcb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4946969..4948309
Genome map
AA seq 446 aa AA seqDB search
MSNTVFIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKQVAGKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGNTALARAEAKSDAAFEFFTKLGVPYYCFHDIDLAPDADDI
GEYENNLKHMVGIAKQRQADTGVKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRAIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVADALLTSSPLETWRAQRYASFDSGAGADFANGTSTLADLATYA
AGKGEPTQLSGRQEAYENLINQYLTR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgttttcatcggcgcgaaagaatatttccccggcatcggcaagatcggc
ttcgaaggccgcgattcggacaacccgcttgcgttcaaggtgtacgacgccaacaagcag
gtcgccggcaagaccatggccgagcacctgcgctttgcagtggcttactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggcacgcgtgcgtatccgtgggatgtgggc
aacaccgcgctggcgcgtgccgaagccaagtccgatgccgcgttcgaattcttcaccaag
ctcggtgtgccgtactactgcttccacgacatcgatctggcgccggatgcggacgacatc
ggcgagtacgaaaacaacctcaagcacatggtgggcatcgccaagcagcgccaggccgac
accggcgtcaagttgctgtggggcaccgccaacctgttctcgcacccgcgctacatgaat
ggtgcgtccaccaatccggacttcaacgtcgtagcgcgcgccgcggtgcaggtcaaggct
gcgatcgatgccacggtggagctgggcggcgagaactacgtattctggggcggtcgcgaa
ggctacgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcacgcgactacgggcgtgcgatcggcttcaaaggcaacttcctgatcgag
cccaagcccatggagccgatgaagcaccagtacgatttcgacagcgccacggtgatcggc
ttcctgcgccagcacggcctggaccaggatttcaagctcaatatcgaagccaaccacgcc
acgctgtcgggtcacagcttcgagcacgacctgcaggtggccagcgatgccggcctgctt
ggcagcatcgatgccaaccgcggcaacccgcaaaacggctgggataccgaccagttcccg
accgacctgtacgacaccgtcggcgcgatgctggtggtgctgcgtcagggcgggctggca
ccgggcgggctgaacttcgatgccaaggtgcggcgtgaatcatccgacccgcaggacctg
ttcctggcccacatcggcggcatggacgcgttcgcacgcgggctggaagtggccgacgcg
ctgctgacctcttcgccgctggaaacctggcgcgcgcagcgttatgccagcttcgacagc
ggcgcgggcgcggactttgcgaacggcaccagcacgttggcggacctggccacgtacgcc
gccggcaagggcgagccgacgcagctcagcggccgccaggaagcctacgagaacctgatc
aatcagtacctgacgcgttga

DBGET integrated database retrieval system