KEGG   Xanthomonas campestris pv. campestris 8004: XC_4210Help
Entry
XC_4210           CDS       T00247                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     XC_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4975017..4976009)
Genome map
AA seq 330 aa AA seqDB search
MSTHACALLLMLTAGLAPAAQAAPLAAGASKFLGSAYGPQQAPGFTQYWNKLTPENAGKW
GSVEAVRDQMDWSGLDTAYNFAKANGMPFQMHVLVWGNQQPEWIKHLPPAEQRREIEQWF
AAVAQRYPDIDLLEVVNEPLNDPPSKDDNGGGNYLQALGGNGASGWEWVLQSFRLARQQF
PRARLMINDYSITNSPQATQRYLQIVQLLQREQLVDAIGVQEHAFETTPNVAMSVHRANL
DTLASTGLPIYITEFDLDGPSDAQQVASYQRVFPVFWEHPAVAGITLWGYRPGLWRDKEA
ACLIRADGSERPALAWLRDYVAQHPGVRAP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcatgcatgcgcactgttgttgatgctcaccgctggcctggcgccagccgcg
caggccgcgccgctggcggcgggtgcgtccaagttcctgggcagtgcctacggcccgcag
caggcgccggggtttacccagtactggaacaagctcacgccggaaaacgccggcaagtgg
ggcagtgtggaggcggtgcgcgaccagatggactggagcggcctggataccgcctacaac
ttcgccaaggccaacggcatgccgttccagatgcacgtgctggtgtggggcaaccagcag
ccggaatggatcaagcacctgccgccggccgagcagcgccgcgagatcgagcaatggttt
gccgcggtggcgcagcgctacccggatatcgacctgctggaagtggtcaacgagccgctg
aacgacccgcccagcaaggacgataacggcggcggcaattatctgcaggcgctcggcggc
aacggtgccagcggctgggagtgggtgctgcaatcgttccggctggcgcgccagcagttt
ccgcgtgcacggttgatgatcaacgactacagcatcaccaatagcccgcaggccacgcag
cgttatctgcagatcgtgcagctgttgcagcgcgagcagctggtggatgcgatcggcgtg
caggaacacgcgttcgaaaccacacccaacgtggcgatgtcggtgcaccgcgccaatctc
gacacgctggccagcaccggcctgccgatctacatcaccgaattcgatctggatggccca
agcgatgcgcagcaggtggccagctaccagcgtgtgtttccggtgttctgggagcacccg
gcggtggccggcatcacgctgtggggctatcgccctggcttgtggcgcgacaaggaagcg
gcttgtctcatccgcgccgatggcagcgagcggccggcgctggcctggttgcgcgactac
gtggcccagcatcctggcgtgcgtgcgccgtga

DBGET integrated database retrieval system