KEGG   Xanthomonas campestris pv. campestris 8004: XC_4302Help
Entry
XC_4302           CDS       T00247                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XC_4302
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XC_4302
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XC_4302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5102827..5103372)
Genome map
AA seq 181 aa AA seqDB search
MSQSIHDIPVTDINGGATSLAAHRGKVLLVVNVASKCGLTPQYEGLEALYRDKQAQGLEV
LGFPANDFNGQEPGSEAEIAQFCQLTYDVTFPLFSKIAVTGAEIHPLYQALTSAQPQATG
DGPMREKLAGYGIAANPAPGVLWNFEKFLIGRDGQVIERFAPDVAADDVRLRQAVDAALA
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagccagagcatccacgacattcccgtgaccgacatcaacggtggcgccaccagcctg
gccgcgcatcgcggcaaggtgctgctggtggtcaacgtcgcctccaagtgcgggctgact
ccccagtacgaaggcctggaagcgctgtaccgcgacaagcaggcccagggcctggaagtg
ctgggtttcccggccaacgacttcaatgggcaggagcccggcagcgaggcggagatcgcc
cagttctgccagcttacctatgacgtcaccttcccgctgttctccaagatcgccgtcacc
ggcgccgagatccatccgttgtaccaggcgctgaccagcgcacagccgcaggccaccggc
gatggcccgatgcgcgaaaagctggccggctacggcatcgccgccaacccggcaccgggc
gtgttgtggaacttcgaaaaattcctgatcggccgcgacggccaggtcatcgaacgcttc
gcacccgacgtcgccgccgatgacgtccgcctgcgccaggccgtcgatgcggcgttggcg
cactaa

DBGET integrated database retrieval system