KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0026Help
Entry
XCC0026           CDS       T00083                                 

Gene name
egl
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XCC0026 (egl)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XCC0026 (egl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(30893..31942)
Genome map
AA seq 349 aa AA seqDB search
MSCSLWLRRLMSCAVFFLLLGVLPMGHAQTRALKYAGVNLAGAEFASSKKPGVLNKDYMY
PASTDYSYFAGTGMNVIRLPILWERLQPAARGELDPAQLALVQQAVARAKASGMYLVLDI
HNYSKYYGYKMGGPEVPLATFADLWRRLAVIFNSDNAVIFGLMNEPNNISASEWAGAAQA
GIDAIRATGANNLILVPGALWTGAHSWHSLTSDGYSNATALASISDPLNRYAFEVHQYLD
ADSSGTSSVCVSETIGADRLRAFTEWLRTNNKRGFLGEFGTANNAVCNTALQGMLAYMEN
YADVWLGWTWWAAGAWWNTSYAYNVHPNKDGTDKPQMVILSPQAARATR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgttctctgtggttgcgcaggctaatgtcctgcgcggtgttcttcctgctgctc
ggtgttctgccgatgggccatgcacaaacgcgtgcactcaagtacgccggcgtcaatttg
gcgggtgcggaatttgcgtcatcgaaaaaacctggcgtcctcaacaaggactacatgtat
cccgccagcaccgattacagctatttcgctgggactggaatgaacgtgattcgcctgccg
atcctgtgggaacgtctgcaacctgccgcacgcggcgagctggatccggcgcagctggca
ctggtgcagcaagcggtggcacgcgccaaggcatcgggcatgtatctggtgctggatatc
cacaactacagcaagtactacggttataaaatgggtgggccggaagtgccgctcgccacc
tttgccgatctgtggcggcgcctggcggtgatcttcaacagcgataacgccgtgatcttc
gggctgatgaatgagcccaacaacatctctgccagcgaatgggccggtgcagcgcaggca
ggcatcgatgcgatccgtgccaccggcgccaacaatctgatcctggtaccgggcgcgctg
tggaccggcgcacacagctggcactcgctgaccagcgatgggtattccaatgcaaccgcg
ttggcatcgatcagcgaccctctcaatcgctatgcgttcgaagtgcatcaatatctggat
gccgattccagcggcacctcaagtgtctgcgtcagtgaaaccatcggcgccgatcgcctg
cgtgcgttcaccgaatggctacgcaccaacaacaagcgtggttttctcggtgagttcggc
accgccaacaacgccgtctgcaataccgcgctgcaaggcatgctggcctacatggaaaac
tacgccgatgtctggctgggctggacatggtgggcagcgggcgcatggtggaacaccagc
tacgcctacaacgtgcatccgaacaaggacggcaccgacaagccgcagatggtcatcctc
tcgccgcaggccgcgcgcgctacacgctga

DBGET integrated database retrieval system