KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0027Help
Entry
XCC0027           CDS       T00083                                 

Gene name
egl
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(32351..33403)
Genome map
AA seq 350 aa AA seqDB search
MSASPSWPRQLLRCALVMLCIATMSIAQAQSPNRLKYAGVNISGAEIQSSKKPGVLNIDY
RYPTASEYRYFAGKQMNIVRLPILWERMQPKAQGPLDQAQLALLKQAVANAKAANQYLII
DVHNYAKYYGQKIGSKRVPVRTFTDLWRRLAIAFKSDNAVIFGLMNEPYDISPESWAAAA
QASIDSIRATGATNLILVPGALWSGAHSWYSTVAGQSNAVALANIRDPLNRYAIEVHQYL
DTDSSGTSAGCVSRTIGAERLRSFTGWLRAQGKRGFLGEFGTANNATCTAALDGMLGYLE
TNHDVWIGWTFWAAGAWWKTSYPFNVQPDAQGRDKPQMKTLSARAHRVTR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctccccctcctggccacgccagctgctgcgctgcgcgttggtcatgctgtgc
atcgccacgatgtccatcgcacaggcgcaaagccccaatcgtctgaaatacgcaggcgtc
aacatctccggtgcggagatccagtcgtccaaaaaaccgggcgtgctcaatatcgactac
cgctatccaaccgcgtccgagtacaggtacttcgcgggcaagcaaatgaacatcgtgcgc
ctgccgatcctgtgggagcgcatgcagcccaaagctcaaggtccgctggatcaggcacaa
ctggcattgctgaagcaggcagtggccaacgccaaggccgccaatcaatacctgattatc
gatgtgcacaactacgccaagtactacggccagaagattggcagtaagcgggtgccggtg
cgcacgttcaccgatctctggcgccgtctggccatcgcgttcaagagcgacaacgccgtg
attttcgggctgatgaacgagccgtacgacatctcgccagagagttgggccgccgccgcg
caggcgtccatcgacagcattcgtgccaccggtgccaccaacctgattctggtgcccggt
gcattgtggtcgggcgcacacagctggtattccaccgtggccgggcagtccaatgcagtg
gcgcttgcgaacatccgcgacccactgaatcgctatgcgatcgaagtccatcaatacctg
gataccgactccagcggcaccagtgccggttgtgtgagccgcacgatcggcgcggagcgc
ttgcgcagtttcaccggctggctgcgcgcgcaaggcaagcgcggttttcttggcgaattc
ggcaccgccaataacgcaacctgcactgcggcgctcgacggcatgctcggttatctcgaa
accaaccacgatgtgtggatcggttggacgttctgggccgcgggcgcgtggtggaaaacc
agctatccgttcaacgtgcagcccgatgcgcaaggccgcgacaagccgcagatgaaaacc
ctgagcgcacgcgcgcatcgcgtcacccgataa

DBGET integrated database retrieval system