KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0121Help
Entry
XCC0121           CDS       T00083                                 

Definition
pectin methylesterase-like protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xcc00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153506..154483
Genome map
AA seq 325 aa AA seqDB search
MQEHRRRVLRSIAASAVLAMSALGSTAAFAADPVYTVAKQGNAGYRTVQAAVDAAVQGGK
RAQISVGAGVYQELLVVPANAPALKMVGAGTTQTVITYDNYAARINPATGKEYGTSGSSS
VIIAGNDFTAEQLSFGNHAGPVGQAVAVRVDGDRAAFRNVRFLGYQDTLYLRGAKLSYFL
DCYVEGTVDFVFGAGTALFENVQLHSLGDGYLTAASTPQESARGFVFRNARITAASGVSR
VFLGRPWRPYASVSFITSQLGAHIVPEGWNNWGNAANEATARYSEYQNTGAGANPSRRVK
WSRQLTAAQAAALDRSTVLGSWRPF
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaacatcgcagacgcgtgttacgcagcatcgccgccagcgccgtgttggcgatg
agcgcactgggcagtaccgcggccttcgctgcagacccggtctataccgtggccaagcag
ggcaacgctggttaccgcaccgtgcaggccgcggtggacgccgccgtgcagggcggcaag
cgcgcgcagatcagcgtcggcgcgggcgtgtatcaagagctgctggtggtgccggccaac
gcaccggcattgaagatggttggcgctggcaccacgcaaaccgtcatcacctacgacaac
tacgccgcgcgcatcaatccggccaccggtaaggagtacggtacctccggctcgtccagc
gtcatcatcgccggcaacgacttcaccgccgagcaactgagcttcggcaaccacgcgggc
ccggtgggccaggcggtggcggtgcgcgtggatggcgaccgcgcggcgttccgcaatgtg
cgtttcctcggctaccaagacacgctgtacctgcgcggcgccaagctctcgtattttctc
gactgctatgtcgaaggcaccgtggatttcgtcttcggcgccggcactgccctgttcgaa
aacgtgcagctgcattcgctgggcgatggctatctcaccgctgcttccacgccgcaggag
agcgcacgcggcttcgtgtttcgcaatgcacgcatcaccgccgccagcggtgtctcgcgc
gtgttcctgggccggccgtggcggccgtacgccagcgtgagtttcatcactagccagctc
ggcgcgcacatcgtgcccgagggctggaacaactggggcaacgcggccaacgaggccacc
gcccgctacagcgaataccagaacaccggcgccggggccaacccgtcgcgccgcgtgaaa
tggtcacgccagctcaccgccgcacaggccgctgcgctggaccgctccaccgtgctgggc
tcctggaggccgttctga

DBGET integrated database retrieval system