KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0135Help
Entry
XCC0135           CDS       T00083                                 

Gene name
glgB1
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180400..182583
Genome map
AA seq 727 aa AA seqDB search
MTAVTNRWDPGVTRALAEARHGDAFAVLGAHPSTNGRLLRTYHPGAEHVTAVLADGREVP
LEAGPEPGLFAGELPAEGRYRLRIGWPGGTQDTADPYAFGPLLSDFDLHLISEGHHLQLA
DALGANAVEVDGVRGTRFAVWAPNASRVAVVGDFNSWDARRHPMRLRHQAGVWELFVPDV
GPGAHYKYQLRGPHGHELPAKADPVARRAELAPGTASIVADPTPHQWSDDGWMATRARRQ
AHDAPMSIYEIHAGSWLREEGLDLDWDGLADRLIPYVADMGFTHVELMPVTEHPFGGSWG
YQPLGLFAPTARFGSPDGFARFVDRCHREGIGVIVDWVPAHFPTDAHGLAHFDGTALYEH
ADPREGFHRDWNTLIYNHGRREVSGFLIASALEFLQRYHVDGLRVDAVASMLYRDYSRNA
GEWVPNIHGGRENYETIAFLRRLNEVVREHAPGAVTIAEESTAWPGVTADVSHGGLGFHY
KWNMGWMHDTLHYIGLDPIYRRYHHGELTFSMVYAYSERFVLPISHDEVVHGKGSLLGRM
PGDDWQRFANLRAYLGFMFTHPGRKLLFMGCEFGQPTEWNHDAGLPWHLLDDARHRGVQT
LVRDLNHLYAQYPALHAHDDDPSGFAWLVGDDAANSVVAFLRKGKRGDAPVLVVINYTPV
VQQGYRLGVPQGGLWREVFNSDAGIYGGANLGNGGAVTAEPQSMHGHAQSLPLLLPPLGV
IVLAPQG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagtgacgaatcgatgggaccccggcgtgacccgcgccctggccgaagcgcgg
cacggcgatgcattcgccgtgctgggcgcacatcccagcaccaacggccgcctgctgcgc
acctatcaccccggcgccgagcacgtcaccgccgtgctggcggatgggcgcgaggtaccg
ctggaagccggcccggaaccgggcctgtttgccggtgaattgccggcggaggggcgctac
cgcctgcggatcggctggccgggcggcacccaggacaccgcagacccgtacgcgttcggg
ccgctgctcagcgacttcgacctgcacctgatcagcgaaggccaccatctgcagctggcc
gatgcgctgggcgccaatgcggtggaagtggacggcgtgcgcggtacgcgctttgcggtg
tgggcaccgaacgcctcgcgcgtggcggtggtaggcgacttcaatagctgggacgcgcgc
cggcacccgatgcggctgcgccaccaggccggcgtgtgggagctgttcgtgcccgacgtg
ggccccggcgcgcactacaaatatcagctgcgtggtccgcatgggcatgaactgccggcc
aaggccgacccggtggcacgccgcgccgaactggcgccgggcactgcctcgatcgtggcc
gaccccacgccgcaccagtggagcgacgacggctggatggccacgcgtgcgcgccgccag
gcgcacgacgcaccgatgagcatctacgagatccatgccggctcctggctgcgcgaggaa
ggcctggatctggattgggatggcctggccgatcgcctgattccgtacgtggccgacatg
ggcttcacccatgtggagctgatgccggtgaccgagcatccgttcggtggctcgtggggc
taccagccgttgggcctgttcgcgcccaccgcgcgcttcggcagcccggatggctttgcg
cgctttgtcgaccgctgccaccgcgaaggcatcggcgtgatcgtggactgggtgccggca
cactttcccaccgacgcgcacggcctggcccacttcgacggcaccgcgctgtatgaacac
gccgacccgcgcgagggcttccaccgcgactggaatacgctgatctacaaccatggccgc
cgcgaggtgtctggctttctgatcgccagcgcgctggagttcctgcagcgctatcacgtc
gatggcctgcgcgtggatgcggtggcctcgatgctctaccgcgactacagccgcaatgcc
ggtgagtgggtgcccaacatccatggcggccgcgaaaactacgaaaccatcgccttcctg
cgccggctcaacgaggtggtgcgcgagcacgcgccgggtgcggtgaccattgccgaagaa
tccaccgcctggccgggcgtgaccgcggatgtgtcgcatggcggcctgggcttccactac
aagtggaacatgggctggatgcacgacacgttgcattacatcgggctggacccgatctat
cgccgctaccaccatggcgagctgactttcagcatggtgtacgcgtactcggagcgcttc
gtgctgccgatctcgcacgacgaagtggtgcacggcaagggctcgttgctgggccgcatg
cccggtgacgattggcagcgtttcgccaacctgcgcgcctatctcggtttcatgttcacc
cacccggggcgcaagttgctgttcatgggctgcgagttcggccagcccaccgagtggaac
cacgacgccggcttgccgtggcatctgctcgacgacgcacgccaccgcggcgtgcagacg
ctggtgcgcgacctcaaccacctgtacgcgcaataccccgccttgcacgcgcacgacgac
gacccatcgggcttcgcgtggctggtaggcgatgacgcggccaacagcgtggtggcgttc
ctgcgcaagggcaaacgcggcgatgcaccggtgctggtggtgatcaactacaccccggtg
gtgcagcaggggtatcgcctcggggtgccgcagggcggcctgtggcgcgaagtgttcaac
agcgatgccggcatctacggcggtgccaacctgggtaacggcggtgcggtgactgccgag
ccgcagtccatgcatggccacgcgcagtcgctaccgttgctgctgccgccgctgggcgtc
atcgtgctggccccgcagggctga

DBGET integrated database retrieval system