KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0237Help
Entry
XCC0237           CDS       T00083                                 

Gene name
mls
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCC0237 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCC0237 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    XCC0237 (mls)
Enzymes [BR:xcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     XCC0237 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
296468..298090
Genome map
AA seq 540 aa AA seqDB search
MSATAASARPVAADRATPGVSLTTQLAGQAELLPAAALALLVSLHRAIEPGRQQRLAQRR
SRQAAFDAGQLPDFRTDTRAIRASDWRVAELPAALQDRRIEITGPTDPKMVINALNSGAK
VFMADFEDSTAPTWRNLLAGQRTLAAAVRGELTFDAPNGKHYALRPEHERAVLIVRPRGW
HLDEKHVLIDGQPMAGGLFDAALFAFHNARTLMAKDRGPYLYLPKLQSMEEAALWETALA
HIEAMLGLPHGQIKVTVLIETLPAVFEMDEILHALRARIVGLNCGRWDYIFSYLKTFRAH
PDRVLPERGQVTMTQPFLKAYSELLIKTCHRRGAHAMGGMAAQIPINHDEAANEQAMARV
RADKLREVSAGHDGTWVAHPALIPVAMAVFDEHMPTAHQHHVLRNDVHITSDMLIATPPG
GITRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRAQLWQWLHHGRHLDDG
TAIDQHLLDTTLRQLPARLGTTAGVPGGARIAEAIGLLDQLSRAEELADFLTVPAYRLID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaccgccgcttccgcccgtcccgtcgccgctgaccgtgccactcccggcgtg
tcgctgaccacccagctggcgggccaggccgagctgctccccgctgccgcgctggccctg
ctggtgtcgctgcaccgggcgatcgagcctggccgccagcagcggctggcgcagcgtcgc
agccgccaggccgcgttcgacgccggccagttgcccgacttccgcaccgacacccgtgcc
atccgcgccagcgactggcgcgtagccgaactgccggccgccctgcaggaccgccggatc
gagatcaccggccctaccgatccgaagatggtcatcaacgcgctgaactccggcgccaag
gtgttcatggccgacttcgaagattccaccgcgcctacctggcgcaacctgctggccggg
cagcgcacgttggcggccgcggtgcgcggcgagctcacattcgatgcgcccaacggcaag
cactacgcgctgcgtccggaacacgaacgtgcggtactgatcgtgcgcccgcgtggctgg
cacctggacgagaagcacgtgttgatcgatggccagccgatggccggcggcctgttcgat
gcggcgctgttcgccttccacaacgcacgcacgctgatggccaaggaccgcggcccgtac
ctgtatctgcccaagttgcagagcatggaagaagccgcgctgtgggagaccgcgctggcg
catatcgaagcgatgctcggcctgccgcacgggcagatcaaggtcaccgtgctgatcgaa
acgctgcctgcggtgttcgagatggacgagatcctgcacgccttgcgcgcacgcatcgtc
gggctcaattgcggccgttgggactacatcttttcgtacctgaaaacctttcgcgcacat
ccggaccgcgtgttgcccgagcgtggccaggtcaccatgacccagccgtttctcaaggcg
tattcggaactgctgatcaagacctgccatcgtcgcggcgcgcatgcgatgggcggcatg
gccgcgcagattccaatcaaccacgacgaggccgccaacgaacaggccatggcgcgcgtg
cgtgccgacaagctgcgcgaagtcagcgccggccatgacggcacctgggtggcgcacccg
gcactgattccggtggcgatggcggtgttcgacgagcacatgcccaccgcgcatcaacac
catgtgctgcgcaacgatgtgcacatcacctccgacatgttgattgccacaccgcccggc
ggcatcacccgcgccggtttcgagggcaatgtcgaggtctgcgtgcgttacctggccgcg
tggctggacggcaatggctgcgtgcccatccataacctgatggaagatgcggccactgcg
gaaatcagccgcgcgcagctgtggcagtggctgcatcacggccgccatctcgatgacggc
accgccatcgaccagcacctgctcgacaccactctgcggcagttgccggcgcgcctgggc
accactgctggcgtgccgggcggcgcacgtatcgccgaggccatcggcttgctcgaccaa
ctgagccgcgccgaggaactggccgacttcctcacggtgcctgcgtatcgcctgatcgac
tga

DBGET integrated database retrieval system