KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0238Help
Entry
XCC0238           CDS       T00083                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCC0238 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XCC0238 (aceA)
Enzymes [BR:xcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     XCC0238 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298246..299571
Genome map
AA seq 441 aa AA seqDB search
MPHPCPRRRTMSTPLQTAEQIQHDWATHPRWAGITRNYTAADVVRLRGTVHVEHSLARLG
ADKLWTSLHATPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLY
PADSVPAVVKRINNTLLRADQLHHAEGDDAIDFLQPIVADAEAGFGGVLNAFELMKAMIE
AGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEA
ADLITSDVDDNDRGFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADVIWCETGKPDLEF
ARAFAQAIHAKFPGKLLAYNCSPSFNWKKNLDDATIARFQTELASYGYKFQFITLAGFHA
LNYGMFHLAHGYARSQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQAIQQGQ
SSTTALRGSTEEAQFHGEKAA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgccccatccctgcccgaggagacgcacgatgagcacaccgctgcagaccgccgaacag
attcagcatgactgggccacccacccgcgctgggccggcatcacccgcaattacaccgcc
gccgatgtggtgcgcctgcgcggcaccgtgcacgtcgagcattcgctggcacggctgggc
gcggacaaactctggacatcgctgcatgccacgcccttcgtcaacgccttgggcgcgctc
accggcaaccaggcgatgcagcaggtcaaggccggcttgaaggcgatctatctctccggt
tggcaggtggcggccgacgccaatctggccgggcagatgtatccggaccaatcgctgtac
ccggccgattcggtgccggcggtggtcaagcgcatcaacaataccttgctgcgcgccgat
cagttgcaccatgccgaaggcgatgatgcgatcgacttcctgcagccgatcgtggccgat
gccgaagccggtttcggtggcgtgctcaatgccttcgaactgatgaaggcgatgatcgaa
gctggcgcagccggcgtgcatttcgaggaccagctggcctcggtgaaaaaatgcggacac
atgggtggcaaggtgttggtgccgacccgcgaagcgatcgagaaattgaatgccgcgcgg
ctggccgccgatgtgctgggcgtgcccaccgtcttgatcgcacgcaccgacgccgaagcc
gccgacctgatcaccagcgacgtggacgacaacgaccgcggtttcaccaccggcgagcgc
actgtggaaggctttttcaagacccgcaacggcctggaccaggccatcagtcgcggcctg
gcctatgcgccgtacgcggatgtgatctggtgcgaaaccggcaagccggacctggagttt
gcccgcgcctttgcgcaggccatccatgccaagttccccggcaagctgctggcctataac
tgctcgcccagcttcaactggaagaagaatctggacgacgccaccatcgccaggttccag
accgaactggccagctatggctacaagttccagttcatcaccctggccggcttccacgcg
ctgaattacggtatgttccacctcgcccacggctatgcgcgcagccagatgagtgccttt
gtcgagctgcagcaagccgagttcgcggccgcagagcgtggctttactgcggtcaagcac
cagcgcgaagtgggcaccggctacttcgatgcagtgacgcaggcgattcagcaggggcag
tcctcgaccaccgcattgcgtggctccaccgaagaagcacagtttcacggcgagaaggcg
gcttag

DBGET integrated database retrieval system