KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0238Help
Entry
XCC0238           CDS       T00083                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:xcc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:xcc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298246..299571
Genome map
AA seq 441 aa AA seqDB search
MPHPCPRRRTMSTPLQTAEQIQHDWATHPRWAGITRNYTAADVVRLRGTVHVEHSLARLG
ADKLWTSLHATPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLY
PADSVPAVVKRINNTLLRADQLHHAEGDDAIDFLQPIVADAEAGFGGVLNAFELMKAMIE
AGAAGVHFEDQLASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTVLIARTDAEA
ADLITSDVDDNDRGFTTGERTVEGFFKTRNGLDQAISRGLAYAPYADVIWCETGKPDLEF
ARAFAQAIHAKFPGKLLAYNCSPSFNWKKNLDDATIARFQTELASYGYKFQFITLAGFHA
LNYGMFHLAHGYARSQMSAFVELQQAEFAAAERGFTAVKHQREVGTGYFDAVTQAIQQGQ
SSTTALRGSTEEAQFHGEKAA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgccccatccctgcccgaggagacgcacgatgagcacaccgctgcagaccgccgaacag
attcagcatgactgggccacccacccgcgctgggccggcatcacccgcaattacaccgcc
gccgatgtggtgcgcctgcgcggcaccgtgcacgtcgagcattcgctggcacggctgggc
gcggacaaactctggacatcgctgcatgccacgcccttcgtcaacgccttgggcgcgctc
accggcaaccaggcgatgcagcaggtcaaggccggcttgaaggcgatctatctctccggt
tggcaggtggcggccgacgccaatctggccgggcagatgtatccggaccaatcgctgtac
ccggccgattcggtgccggcggtggtcaagcgcatcaacaataccttgctgcgcgccgat
cagttgcaccatgccgaaggcgatgatgcgatcgacttcctgcagccgatcgtggccgat
gccgaagccggtttcggtggcgtgctcaatgccttcgaactgatgaaggcgatgatcgaa
gctggcgcagccggcgtgcatttcgaggaccagctggcctcggtgaaaaaatgcggacac
atgggtggcaaggtgttggtgccgacccgcgaagcgatcgagaaattgaatgccgcgcgg
ctggccgccgatgtgctgggcgtgcccaccgtcttgatcgcacgcaccgacgccgaagcc
gccgacctgatcaccagcgacgtggacgacaacgaccgcggtttcaccaccggcgagcgc
actgtggaaggctttttcaagacccgcaacggcctggaccaggccatcagtcgcggcctg
gcctatgcgccgtacgcggatgtgatctggtgcgaaaccggcaagccggacctggagttt
gcccgcgcctttgcgcaggccatccatgccaagttccccggcaagctgctggcctataac
tgctcgcccagcttcaactggaagaagaatctggacgacgccaccatcgccaggttccag
accgaactggccagctatggctacaagttccagttcatcaccctggccggcttccacgcg
ctgaattacggtatgttccacctcgcccacggctatgcgcgcagccagatgagtgccttt
gtcgagctgcagcaagccgagttcgcggccgcagagcgtggctttactgcggtcaagcac
cagcgcgaagtgggcaccggctacttcgatgcagtgacgcaggcgattcagcaggggcag
tcctcgaccaccgcattgcgtggctccaccgaagaagcacagtttcacggcgagaaggcg
gcttag

DBGET integrated database retrieval system