KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0411Help
Entry
XCC0411           CDS       T00083                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xcc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
497641..499572
Genome map
AA seq 643 aa AA seqDB search
MSTQELHALAAAAGVMVDWVDASDQPRQVAPESIHAVLTALELPAANAAQRADSLQRIRA
TAAEPAPLVTVKVGEPLPLRVAPNAQGRWQAEDGSSEAARADAQGRLLAPARFGYWTLEL
GTTAQQVAVAPQRCFSVADACGQPAPRAWGMALQVYSARSADDGGIGDAAGAMEWVRQAA
GANADALALSPVHASRPITGGYSPYSPSDRRFLDPLHAAPVRVLGDAVHTAIAAVPGLRE
RLDGLHGTALIDWPASAAAKWELLRQLSTQVTPDHPELAAFRAQGGAALEAFAHFAARDF
GDGDAHLHVFTQWLAARSWADVQREAHERGMRIGLIADLAVGFDPNGAEAAAAADTVLRG
LVLGAPPDAFNADGQHWGIGAYSPTALRRSGFAPYIALLRAVLRDRGGIRIDHILGLLRL
WVVPDGASSGDGAYLAYPLQDLLNLLALESWRHRAIVIGEDLGVVPPGIREELSRRGVMG
IDVLMFTRDQEGAFVPPALWRADAVATTTTHDLPTLTGWRAGRDIDWRRKLELIQPAQAQ
ADHQTRTRDASRLDAAVADAGLGSDAPLLDALRFTASSVSPLALLPVEDALALDEQPNLP
GTVEVHPNWRRRLPDPLPQAQLTAALQGFAEARRVSAVSEPHP
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaggaactgcatgccctggccgccgcggccggggtgatggtggattgggtg
gacgccagcgaccagccgcgccaggtggcgccggagtcgatccatgccgtgctcaccgcg
ctggaattgcccgctgccaacgccgcgcagcgcgccgacagcctgcagcgcatccgcgcc
actgccgccgagccggcgccgctggtgacggtgaaggtgggcgagcccttgccgttgcgg
gttgcgcccaacgcacagggccgctggcaggccgaagacggcagcagcgaggccgcgcgt
gccgatgcgcagggccggctgttggcgccggcgcgctttggctactggacgctggaactg
ggcaccacggcccagcaggtggccgtggcgccgcagcgctgcttcagcgtggccgacgcc
tgtggccagccggcgccgcgtgcgtggggcatggcgctgcaggtgtattcggcccgcagc
gccgacgatggcggcattggcgatgcggccggagccatggagtgggtgcggcaggccgcc
ggcgccaatgccgatgcgttggcgctgagcccggtgcatgcctcgcgcccgatcaccggc
ggctacagcccgtattcgcccagcgaccggcggttcctggaccccttgcacgccgcaccg
gtgcgcgtgctgggcgatgccgtgcacacggcgattgctgccgtgcccggcctgcgcgag
cgcctggacgggctgcatggcaccgcattgatcgactggccggcctcggccgctgccaag
tgggaactgctgcgccagctgtccacccaggtgacgccagaccacccggagctggcggcg
tttcgcgcccagggtggcgcggcgctggaggcatttgcgcacttcgccgcgcgcgacttc
ggcgatggcgatgcgcacctgcatgtgttcacccaatggctggccgcccgcagctgggcc
gacgtgcaacgtgaagcgcacgagcgcggcatgcggatcggcctgattgccgatctggcg
gtgggctttgatccgaatggtgccgaagccgccgccgcggccgacaccgtactgcgcggg
ctggtgctgggcgcgcccccggacgccttcaatgccgatggccagcactggggcatcggt
gcgtactcgcccaccgcgctgcgccgtagcggatttgcgccgtatatcgcgctgctgcgt
gcggtgctgcgcgaccgtggcggcatccgcatcgatcacatcctgggcctgctgcggctg
tgggtggtgcccgatggcgccagctccggcgatggcgcctacctggcgtatccgctgcag
gacctgctcaatctgctcgcgctggaatcctggcggcatcgcgccatcgtgatcggcgaa
gacctgggcgtggtgccgccgggcatccgcgaagagctctcgcgccgcggcgtgatgggc
atcgacgtgctgatgttcacccgcgaccaggagggtgccttcgtgccgccggcgctgtgg
cgtgcggacgcggtggccaccaccaccactcacgatctgcccaccctgaccggctggcgc
gccggccgcgacatcgactggcgccgcaagctcgagctgatccagccagcgcaggcgcag
gccgaccaccagacgcgcacgcgcgacgcttcgcgtctggacgcggccgtggccgacgcc
ggcctgggcagcgatgcgccgttgctggatgcgttgcgcttcaccgccagcagtgtgtcg
ccgctggccctgctgccggtggaagacgcgctggcgctggacgaacaacccaatctgccg
ggcaccgtcgaggtccatcccaattggcgccgacgcctgcccgaccccttgccccaggcg
cagctgaccgccgcgctgcagggttttgccgaggcgcgccgcgtctcggccgtttcggaa
ccgcatccatga

DBGET integrated database retrieval system