KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0470Help
Entry
XCC0470           CDS       T00083                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xcc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:xcc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571780..572577
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEIAERSARVPLAELVARSADLPLTRGFAAAMKASIAAGEPAVIAEV
KKASPSKGVIRPDFHPADIAVSYEFGGASCLSVLTDMYFFQGSDAYLQQAREACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDQQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLVGINNRNLRTFEVSLQTTLDMRAAVPRDRVLVTESGIVTASDVQLMRSNGVNA
FLVGETFMRAPEPGEALRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctcaacaccatccttgcccgcaaggccgacgaaatcgccgagcgcagc
gcacgcgtgccgctggccgagctggtcgcgcgtagcgcagacctgccgctcacccgcgga
tttgccgccgccatgaaggccagcattgccgccggcgagccagccgtgattgccgaagta
aagaaggccagcccgtccaagggcgtgatccggcccgacttccatccggctgacatcgcg
gtcagctacgagttcggtggtgccagctgcctgtcggtgctgaccgacatgtatttcttc
cagggctccgatgcgtatctgcagcaggcacgcgaggcctgcaccttgccggtgctgcgc
aaggatttcaccgtcgatccgtaccaggtctacgaggcgcgcgtgctgggcgccgactgc
atcctgctgatcgtctcggcgctggaggaccagcaactggccgacctgtccggtctggcg
atgcagttgggcctggatgtgctggtggaagtgcacgacatcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgctggtgggcatcaacaaccgcaacctgcgcaccttcgaggtg
tcgttgcagaccaccctggacatgcgcgcagctgtgccgcgtgatcgcgtcctggtcacc
gaaagcggcatcgtcaccgcatccgacgtgcagttgatgcgcagcaacggcgtgaacgcg
tttctggtcggcgagaccttcatgcgcgcgcccgaacccggcgaagcactgcgtcagcta
ttctttgcgcatgactga

DBGET integrated database retrieval system