KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0470Help
Entry
XCC0470           CDS       T00083                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XCC0470 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCC0470 (trpC)
Enzymes [BR:xcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XCC0470 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
571780..572577
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEIAERSARVPLAELVARSADLPLTRGFAAAMKASIAAGEPAVIAEV
KKASPSKGVIRPDFHPADIAVSYEFGGASCLSVLTDMYFFQGSDAYLQQAREACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDQQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLVGINNRNLRTFEVSLQTTLDMRAAVPRDRVLVTESGIVTASDVQLMRSNGVNA
FLVGETFMRAPEPGEALRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctcaacaccatccttgcccgcaaggccgacgaaatcgccgagcgcagc
gcacgcgtgccgctggccgagctggtcgcgcgtagcgcagacctgccgctcacccgcgga
tttgccgccgccatgaaggccagcattgccgccggcgagccagccgtgattgccgaagta
aagaaggccagcccgtccaagggcgtgatccggcccgacttccatccggctgacatcgcg
gtcagctacgagttcggtggtgccagctgcctgtcggtgctgaccgacatgtatttcttc
cagggctccgatgcgtatctgcagcaggcacgcgaggcctgcaccttgccggtgctgcgc
aaggatttcaccgtcgatccgtaccaggtctacgaggcgcgcgtgctgggcgccgactgc
atcctgctgatcgtctcggcgctggaggaccagcaactggccgacctgtccggtctggcg
atgcagttgggcctggatgtgctggtggaagtgcacgacatcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgctggtgggcatcaacaaccgcaacctgcgcaccttcgaggtg
tcgttgcagaccaccctggacatgcgcgcagctgtgccgcgtgatcgcgtcctggtcacc
gaaagcggcatcgtcaccgcatccgacgtgcagttgatgcgcagcaacggcgtgaacgcg
tttctggtcggcgagaccttcatgcgcgcgcccgaacccggcgaagcactgcgtcagcta
ttctttgcgcatgactga

DBGET integrated database retrieval system