KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0542Help
Entry
XCC0542           CDS       T00083                                 

Gene name
phdB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:xcc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xcc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:xcc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:xcc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656574..658331
Genome map
AA seq 585 aa AA seqDB search
MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKATMEVPSSVAGVVKEI
KVKVGDSLSQGALVALIEVADADAGAETAAAPAPAAAPAKAAPAAAPAPAAKAAPAAASD
GGQVEARVPDIGDYSGVPVIEVLVAVGDTVAKDQSLVTLESDKATMEVPSSVAGVIKELK
VKVGDSLSQGDLVAIIAASDGGAGAAQSPAKPTTDTAETAGKVEPVAVPAEPDKLAQREI
AQVQSARSTAASQPAQAAPGTPSSPPVTFDADSVLPSKVPYASPVVRVFARELGVDLNQI
KGSEKGGRITREDVQRFVKAALSGGAPAAAGAAPAGGGNGLNLLAWPKVDFSKFGETETQ
PLSRIKKISGANLARNWAMIPHVTQFESADITDLEALRVALNKENEKAGIKLTMLAFLIK
ASAAALKKFPEFNASLDAAGENLTLKKYINIGFAADTPNGLVVPVIRDVDKKGVLQIAQE
SGELAKKARDGKLGPADMSGGCFSISSLGGIGGTAFTPIINAPEVAILGVSKSAMQPVWN
GKDFAPKLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaggaagcacttgtccccgatatcggtgactacagcgatgtcccggtg
atcgaagtgctggtgtcggtcggcgatacggtcagcaaggaccagagcctggtcacgctg
gaatcggacaaggccacgatggaagtcccctcgtcggtggccggcgtggtcaaggagatc
aaggtcaaggtcggtgacagcctgtcgcagggcgcgctggtcgcgctgatcgaagtagcc
gatgccgatgccggtgccgagacggctgcggcgccagcgcctgccgctgcgcccgccaag
gccgcacctgctgccgctcctgcgccggctgccaaggccgcgcctgccgcagcgtccgac
ggcggtcaggtcgaggcccgtgtgccggacatcggcgactacagcggcgtgccggtgatc
gaagtgctggtggcggtgggcgacaccgtcgccaaggaccagagcctggtcacgctggaa
tcggacaaggccacgatggaagtgccctcgtctgtggccggcgtgatcaaggagctcaag
gtcaaggtcggcgacagcctgtcgcagggcgatctggtggcgatcatcgctgccagcgat
ggcggcgccggtgcggcgcagtccccggccaagcccaccaccgacaccgctgaaaccgcc
ggcaaggtcgagccggtggccgtcccggccgagccggacaagctggcccagcgcgagatc
gcgcaggtgcagtcggcacggtccaccgcggcatcgcagccggcccaggcagcgcccggc
accccgagcagcccgccggtgaccttcgatgccgacagcgtgctgccgtccaaggtgccg
tatgccagcccggtggtgcgcgtgttcgcgcgcgagctcggcgtggatctgaaccagatc
aagggcagcgagaagggcggccggatcacccgtgaagacgtgcagcgcttcgtcaaggcc
gcactcagcggcggcgcgccggccgcagccggtgccgcaccggccggtggtggcaacggc
ctgaacctgctggcctggccgaaggtggacttcagcaagttcggcgaaaccgaaacccag
ccgctgtcgcgcatcaagaagatttccggtgcgaacctggcgcgcaactgggccatgatc
ccgcacgtcacccagttcgaatcggccgacatcaccgacctggaagccctgcgcgtggcg
ctgaacaaggaaaacgaaaaggccggcatcaagctgaccatgctcgccttcctcatcaag
gccagtgccgcggcgctgaagaagttccccgagttcaacgcctcgctcgacgcggccggc
gaaaacctcacgctgaagaagtacatcaacatcggctttgccgctgacaccccgaacggc
ttggtcgtgccggtgatccgcgacgtcgacaagaagggcgtgctgcagatcgcgcaggaa
agtggcgagctggccaagaaggcacgcgacggcaagctgggcccggccgacatgagcggc
ggctgcttctcgatcagctcgctcggtggcattggcggcaccgcgttcacgccgatcatc
aatgcaccggaagtggcgatcctgggcgtgtccaagtcggcgatgcagccggtctggaac
ggcaaggacttcgcaccgaagctgatgctgccattgtcgttgagctacgaccaccgcgtc
atcgacggcgcgctggccgcgcgcttcaccacctatctcagccaggtgctcgccgacatg
cgacgcgtcctgctgtga

DBGET integrated database retrieval system