KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0542Help
Entry
XCC0542           CDS       T00083                                 

Gene name
phdB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XCC0542 (phdB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC0542 (phdB)
   00020 Citrate cycle (TCA cycle)
    XCC0542 (phdB)
   00620 Pyruvate metabolism
    XCC0542 (phdB)
Enzymes [BR:xcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XCC0542 (phdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
656574..658331
Genome map
AA seq 585 aa AA seqDB search
MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKATMEVPSSVAGVVKEI
KVKVGDSLSQGALVALIEVADADAGAETAAAPAPAAAPAKAAPAAAPAPAAKAAPAAASD
GGQVEARVPDIGDYSGVPVIEVLVAVGDTVAKDQSLVTLESDKATMEVPSSVAGVIKELK
VKVGDSLSQGDLVAIIAASDGGAGAAQSPAKPTTDTAETAGKVEPVAVPAEPDKLAQREI
AQVQSARSTAASQPAQAAPGTPSSPPVTFDADSVLPSKVPYASPVVRVFARELGVDLNQI
KGSEKGGRITREDVQRFVKAALSGGAPAAAGAAPAGGGNGLNLLAWPKVDFSKFGETETQ
PLSRIKKISGANLARNWAMIPHVTQFESADITDLEALRVALNKENEKAGIKLTMLAFLIK
ASAAALKKFPEFNASLDAAGENLTLKKYINIGFAADTPNGLVVPVIRDVDKKGVLQIAQE
SGELAKKARDGKLGPADMSGGCFSISSLGGIGGTAFTPIINAPEVAILGVSKSAMQPVWN
GKDFAPKLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatcaaggaagcacttgtccccgatatcggtgactacagcgatgtcccggtg
atcgaagtgctggtgtcggtcggcgatacggtcagcaaggaccagagcctggtcacgctg
gaatcggacaaggccacgatggaagtcccctcgtcggtggccggcgtggtcaaggagatc
aaggtcaaggtcggtgacagcctgtcgcagggcgcgctggtcgcgctgatcgaagtagcc
gatgccgatgccggtgccgagacggctgcggcgccagcgcctgccgctgcgcccgccaag
gccgcacctgctgccgctcctgcgccggctgccaaggccgcgcctgccgcagcgtccgac
ggcggtcaggtcgaggcccgtgtgccggacatcggcgactacagcggcgtgccggtgatc
gaagtgctggtggcggtgggcgacaccgtcgccaaggaccagagcctggtcacgctggaa
tcggacaaggccacgatggaagtgccctcgtctgtggccggcgtgatcaaggagctcaag
gtcaaggtcggcgacagcctgtcgcagggcgatctggtggcgatcatcgctgccagcgat
ggcggcgccggtgcggcgcagtccccggccaagcccaccaccgacaccgctgaaaccgcc
ggcaaggtcgagccggtggccgtcccggccgagccggacaagctggcccagcgcgagatc
gcgcaggtgcagtcggcacggtccaccgcggcatcgcagccggcccaggcagcgcccggc
accccgagcagcccgccggtgaccttcgatgccgacagcgtgctgccgtccaaggtgccg
tatgccagcccggtggtgcgcgtgttcgcgcgcgagctcggcgtggatctgaaccagatc
aagggcagcgagaagggcggccggatcacccgtgaagacgtgcagcgcttcgtcaaggcc
gcactcagcggcggcgcgccggccgcagccggtgccgcaccggccggtggtggcaacggc
ctgaacctgctggcctggccgaaggtggacttcagcaagttcggcgaaaccgaaacccag
ccgctgtcgcgcatcaagaagatttccggtgcgaacctggcgcgcaactgggccatgatc
ccgcacgtcacccagttcgaatcggccgacatcaccgacctggaagccctgcgcgtggcg
ctgaacaaggaaaacgaaaaggccggcatcaagctgaccatgctcgccttcctcatcaag
gccagtgccgcggcgctgaagaagttccccgagttcaacgcctcgctcgacgcggccggc
gaaaacctcacgctgaagaagtacatcaacatcggctttgccgctgacaccccgaacggc
ttggtcgtgccggtgatccgcgacgtcgacaagaagggcgtgctgcagatcgcgcaggaa
agtggcgagctggccaagaaggcacgcgacggcaagctgggcccggccgacatgagcggc
ggctgcttctcgatcagctcgctcggtggcattggcggcaccgcgttcacgccgatcatc
aatgcaccggaagtggcgatcctgggcgtgtccaagtcggcgatgcagccggtctggaac
ggcaaggacttcgcaccgaagctgatgctgccattgtcgttgagctacgaccaccgcgtc
atcgacggcgcgctggccgcgcgcttcaccacctatctcagccaggtgctcgccgacatg
cgacgcgtcctgctgtga

DBGET integrated database retrieval system