KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0648Help
Entry
XCC0648           CDS       T00083                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XCC0648 (holC)
   00240 Pyrimidine metabolism
    XCC0648 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XCC0648 (holC)
   03430 Mismatch repair
    XCC0648 (holC)
   03440 Homologous recombination
    XCC0648 (holC)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XCC0648 (holC)
DNA replication proteins [BR:xcc03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XCC0648 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(776594..777019)
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLDEPLRLVCELARKANDANLSTLILARDAAQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIATPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgacttttacctgatcgccaaaccgcgcttcctcgacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgatgccaacctgtccacgctgatcctggcg
cgcgatgccgcacaggccgaggcgctggatgacctgttgtgggcgttcgacgacgaagcc
tatgtgccgcaccagatcgccggcaccgatgaggaagacgaactggcgccggtgctgatc
gcaacgcccgagttcgccgcgccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctggaagtggtgcccgccgaccccgccgcccgcgaa
ccgctgcgcgaacgctggaagcagtacaaggccctgggcctggaactcacgaaatacgac
atgtag

DBGET integrated database retrieval system