KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0655Help
Entry
XCC0655           CDS       T00083                                 

Gene name
dsbC
Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
Enzymes [BR:xcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XCC0655 (dsbC)
Secretion system [BR:xcc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XCC0655 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
783226..784020
Genome map
AA seq 264 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASNTAAKPAAAPATGNVDQRVGAALKALDPDFKPD
YIGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASEGLLAYRRKQLQTVP
KADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDHK
EMIAVWCAADRKQALTAAKSGQPVNAKDCKNPVSMEYTLGQRLGVNGTPAIFAPDGTQLG
GYLPPAQLREALEKRAVTTAGGSR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcattgctcggcgcgatcagccttaccgcctgcgcgcag
tcttcgcagccggccgcgagcaacaccgccgccaagcctgccgccgcaccggccacgggc
aatgtggaccagcgcgtgggcgccgcgctcaaggcgctggacccggatttcaagccggac
tacatcggcgcggccccgttcccgggcttccgcgaagtggtcgtcggcgggcaggtgctg
tacgtcagcgatgacggccggtacctgatccaggcgcagccgttcgacatccagaacaag
cagttcgccgccagcgagggcctgctggcctaccgccgcaagcagctgcagaccgttccc
aaggccgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtgacggtgttcacc
gatgtggaatgcggctactgccgcaagctgcacagcgagatcggtgagctcaacaagcag
ggcatcgcggtggaatatctggccttcccgcgcatgggcctgggcagccaggaccacaag
gaaatgatcgcggtgtggtgcgcagccgaccgcaagcaggcgctcaccgcggccaagtcc
ggccagccggtcaacgccaaggactgcaagaacccggtgtcgatggagtacaccctgggc
cagcgcctgggcgtgaacggcaccccggcgatcttcgcgcccgacggcacccagctgggt
ggctacctgccgccggcacagctgcgcgaggcgctggaaaagcgcgcggtcaccacggcg
ggcggcagccgctaa

DBGET integrated database retrieval system