KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0747Help
Entry
XCC0747           CDS       T00083                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC0747
  Energy metabolism
   00680 Methane metabolism
    XCC0747
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCC0747
Enzymes [BR:xcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XCC0747
Membrane trafficking [BR:xcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    XCC0747
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XCC0747
  Exosomal proteins of melanoma cells
   XCC0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(893187..893774)
Genome map
AA seq 195 aa AA seqDB search
MQQRALHFDQVHVSTLERAQATAAIILHDVAPMPEVVSSAALVERNFGIFAGKNKTLIKK
SVGHAVFERYFHDADGAPPDGEHWMDMYARCKTYYETVLAPLDQQAKHVLVVAHKYIVEV
LALIASGLPPAEYIDFRLPNSRPLSWDELKQLTARSSSHLNTLGELTEIHLLRWMLLATL
GGLHCRAWAQRCHLR
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcaacgcgcactgcacttcgaccaggtgcatgtctccacgctggagcgcgcgcag
gcaacggcagccatcatcctgcatgacgttgcgcccatgcccgaggtcgtttccagcgcg
gcactggtggaacgcaacttcggcatcttcgccggcaagaacaagaccttgatcaagaag
tcggtcggccatgcggtgtttgaacgctacttccatgatgccgatggcgcgccaccggac
ggcgaacactggatggatatgtacgcccgctgcaagacctactacgagaccgtgctggcg
ccgctggatcagcaagccaagcacgtgctggtcgtcgcgcacaaatacatcgtggaagtc
ttagcgctgatcgcatccgggctgccgccagcggagtacatcgacttccgcttgcccaac
tcgcgcccgctgtcatgggacgaactcaagcaactgaccgcgcgcagttcgtcacacctc
aatacgctgggcgaattgacggaaatccacctgctgcgctggatgctgctcgccacgctc
ggtggtttgcactgtcgtgcatgggcgcagcgctgccacctgcgttag

DBGET integrated database retrieval system