KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0778Help
Entry
XCC0778           CDS       T00083                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xcc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
937987..938610
Genome map
AA seq 207 aa AA seqDB search
MSLWLLTLSLLAPGIASAKSPATAAPILVVGDSLSAAHNIPVQSGWVTLLDQRLKRDMAT
PPPVVNASISGETTSGALTRLPGLLQKHRPGVVVIELGGNDALRGLTPAQLKGNLEKMIQ
FSRQAGAKVLLLGIDVPPNYGPAYRERLKATYADLSKQYQTALVPFFLEKVALQPGLMQA
DGLHPTAAAQPKVLETVWPALQPLLKP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtggctgctgacactctccctgcttgcgccggggattgcctctgccaaaagt
ccggccactgccgcgccgatcctggtagtgggcgacagcctgagcgccgcgcacaacatc
ccggtgcagtccggctgggtcaccctgctggaccagcgcctgaagcgtgacatggcgacg
ccaccgccggtcgtcaatgccagcatcagcggcgaaaccacctccggcgccttgacccgg
ctgcctgggctgctgcaaaagcaccgccccggcgtggtcgtcatcgagctgggtggcaac
gatgccttgcgtggcctcacgccggcccagctcaagggcaacctggagaagatgatccag
ttcagccgtcaggcgggcgcgaaggtcttgctgctgggcatcgatgtgccgcccaactat
ggcccggcctatcgcgagcggctgaaggcgacctatgccgacctctccaagcaataccag
accgcgctggtgccgttctttctcgagaaggtcgccctgcagccgggcctgatgcaggcc
gacggcctgcaccccaccgccgccgcacagcccaaggtgctggaaacggtctggccagca
ctgcagccgctgctcaaaccctga

DBGET integrated database retrieval system