KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0871Help
Entry
XCC0871           CDS       T00083                                 

Gene name
ipk
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00900  Terpenoid backbone biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCC0871 (ipk)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     XCC0871 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C RRM_1
Motif
Other DBs
NCBI-GeneID: 1001446
NCBI-ProteinID: NP_636262
UniProt: Q8PC64
Position
1031450..1032337
Genome map
AA seq 295 aa AA seqDB search
MDALALMSASNPAWSAWPAPAKLNLFLQIVGRRADGYHLLQTVFRLLDWGDTVHVRLRTD
GQIQRIGASLPGVAEDDDLMVRAARALQIHAGTALGAELRVDKRIPAGGGFGGGSSDAAT
VLVALNALWGLGLPVDTLAELGLRLGADVPVFVRGHNAWAEGVGEKLTPISLPQAAYVLV
DPGIHVPTPVLFQSQELTRDAAPAKIADFASGSLLDNAFEPVLRRREPAIEAVFQALSRI
GTPRLTGSGSGCFVEFATRAAAEQAMAHLPGNLRAWVVEGAAHSPLLDALDAIQV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacgctctcgccctgatgtctgcgtcgaaccctgcctggtcggcctggcctgcgccg
gccaagctcaacttgttcctgcaaatcgtcgggcgccgcgccgatggctatcacctgctg
cagaccgtgttccgcctgctcgactggggggacaccgttcatgttcgtttgcgcaccgac
ggccagatccagcgcattggcgccagcctgccgggcgtcgccgaagacgacgatctcatg
gtgcgtgcggcgcgcgcgctacaaattcatgccggcaccgcgctcggggctgagttgcgg
gtcgacaagcgcatccccgccggcggtggcttcggtggcggctcctcggatgccgccacc
gtgctggtggccctgaatgccttgtggggcctgggcttgccggtcgacaccctggccgaa
ctgggcctgcgcctcggcgccgatgtgccggtattcgtgcgtgggcacaacgcctgggcc
gaaggtgtgggcgaaaaattgaccccgatcagcctgccgcaggcggcctacgtgctggtc
gaccccggtattcacgtgcccacgccggtcctgtttcaatcacaggaattgacgcgggat
gctgcgcccgcgaaaatagcggacttcgcttccggttctctgctcgacaatgcgttcgag
ccggtcctgcggcgccgggaacctgccatcgaggccgtgttccaggcgctttccaggatc
ggaacgccacgtttgacagggtcggggagcggttgtttcgtcgaattcgccacgcgcgct
gctgcagagcaggccatggcgcatttgccgggcaacctgcgggcgtgggtcgtggagggt
gcagcgcactcgccattgctcgacgcactggacgcgatacaggtttga

DBGET integrated database retrieval system