KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1003Help
Entry
XCC1003           CDS       T00083                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XCC1003 (recR)
DNA repair and recombination proteins [BR:xcc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XCC1003 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153079..1153672
Genome map
AA seq 197 aa AA seqDB search
MSSLLEQLIEAFRVLPGVGQKSAQRMAYHVLEREREGGRRLAAALANAVEKVGHCVQCRD
FTESEVCAICANSGRDRQQLCVVESPADRLAIEHATGYRGVYFILQGRLSPLDGIGPREL
GLDRLAERLAAGEVTEMIIATNATVEGEATAHYLAQLARQHSVRPSRLAQGMPLGGELEY
VDRGTLSHAFGTRSEVL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcccttctagaacaactgatcgaagccttccgggtgctgcccggtgtgggtcag
aagtcggcgcagcgcatggcgtaccacgtgctcgagcgtgagcgcgagggtgggcggcgg
ctggcggcggcgttggccaatgcggtggagaaggtgggccattgcgtgcaatgccgcgac
ttcaccgagtcggaggtgtgcgcgatctgcgccaattccggccgtgatcggcagcagctg
tgcgtggtggaatcgcccgccgatcgcctggcgatcgagcacgccaccggctaccgcggg
gtgtatttcatcctgcaggggcgtttgtcgccgctggatggtatcggcccgcgtgagttg
gggctggaccgcctggccgagcgtctggcagcgggcgaggtcaccgaaatgatcatcgcc
accaacgccaccgtcgagggcgaggccaccgcgcattacctggcgcaactggcccgccaa
cacagcgtgcgccccagccggcttgcacaaggcatgccgctgggcggcgagctggagtac
gtggatcgcggcacgctgtcgcatgccttcggcacgcgtagtgaggtgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system