KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1067Help
Entry
XCC1067           CDS       T00083                                 

Definition
type III restriction-modification enzyme, helicase subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     XCC1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227462..1230584
Genome map
AA seq 1040 aa AA seqDB search
MPGQGQNQGLKIVSDQFFKQPILNSPYGYPSLHWELDEKGQPTQQVVKSRRASSFVSPIP
KPRRHQGEQATLALDEVESLADDGQRYRHSELINSVRREVDAWRLLPPAQWRVTPETARL
LEHWRNHKFAGVRPFFCQVEAAETAIWLAEVAPQLGKNGERFLDHLKKASTDANPGLMRL
ALKLATGAGKTTVMAMLIAWQTVNAVRHPQSKKFTRGFLLVAPGLTIKDRLRVLLPNDAD
SYYANREIVPRDMLADLDKAKIVITNYHAFKRRERMELSKGGRRLLQGRTGSELETLETE
GQMLQRVMPELMGLKNILAINDEAHHCYREKPHAAVDDEDLDKDQKAEAEDNNEAARLWI
SGLEAVNRKLGLQQVMDLSATPFFLAGSGYVEGTLFPWTMSDFSLMDAIECGIVKLPRVP
VADNIPGAEMPIYRELWKHIGKKMPKKGRGKNAQLDPLAIPVELQTALEALYGHYLKTYE
AWKQAGINVPPCFIVVCNNTATSKLVFDYISGFERTNEDGSSTRVPGRLELFRNFDEHGE
PLARPNTLLIDSEQLESGEALDDNFRGMAADEIERFKREIIERTGDRGQAENLSDSELLR
EVMNTVGKQGRLGEQIRCVVSVSMLTEGWDANTVTHILGVRAFGTQLLCEQVIGRALRRQ
SYELNEQGLFDVEYADVFGIPFDFTAKPVVVTPPKPRETITVKALRPERDHLEIWFPRVQ
GYRVELPEEQLEAEFNDDHHVSLTPDRVGATKTHNAGIIGEAVELDIKHLGDVRQSTLLM
ELTKHLLFQHWRDKGQDAPIALFGQLKRIVRQWLDECLECKGGTYPAQLMYRELADMACQ
RITKGITAKELEKGRQVKAILDPFNPTGSTAHVRFNTSRPGSERWETLGVENQPKNQVNW
VILDSGWEGEFCRIAESHPKVLAYTKNHNLGLEVPYRFGSANRIYIPDFIVQVDDGRGKN
DSLNLIVEIKGYRREDAKEKKSTMDTYWIPGVNHLGTHGRWAFVEFGDVYEMQDDFAKEV
EAKFNQMIETAVPAPGNKEY
NT seq 3123 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggcagggccaaaatcaggggttaaagatagtgagtgaccagtttttcaagcag
cctattctcaattctccatacggttacccgtctttgcactgggagctcgacgaaaagggg
caacctacacagcaagtagtcaaatctcgccgagcatccagcttcgttagtccgattcca
aagccacgtcggcaccagggcgagcaggctaccctggcgctggatgaagttgagagcctg
gctgacgacgggcagcgctaccgacactctgagctaatcaattcggtgcggcgggaggtc
gatgcttggcgtctcttgccacctgcgcagtggcgcgtcacccctgaaacagcccgctta
ctggaacattggcgcaaccacaagttcgccggtgtgcgcccattcttttgccaagtagaa
gcggccgagaccgccatctggttggccgaggtcgctccacagcttggaaagaacggcgag
cgcttcctcgatcacctgaaaaaggccagcactgatgccaatcccggcttgatgcgtttg
gcgctgaagctggcgactggtgcaggcaagaccacggtcatggccatgctcattgcctgg
cagacggttaatgccgtacggcatccgcagagcaagaaattcacccgtggtttcttgctg
gtcgctcctggcctgaccatcaaggatcgtttgcgtgtgctattgcccaatgatgcagac
agctactacgccaaccgcgaaatcgtgccacgcgacatgctggccgatttggacaaggcc
aagatcgttatcaccaattaccacgctttcaagcgacgtgaacgcatggagctgtccaag
ggcggccgccgcctgttgcaaggccgtaccggcagcgagctggaaacgctggaaaccgag
ggacagatgctccagcgagtcatgccggaattgatggggctgaagaatattcttgccatc
aacgacgaggcacaccattgctatcgggagaagccgcacgctgccgtagacgatgaagat
ctcgataaagatcagaaagcggaagccgaggacaacaatgaagccgctcggctttggatt
tctggcctagaagcggtcaaccgcaagctggggctgcagcaggtgatggacctgtctgca
acgcctttcttcctggccggctctggctatgtggagggcacgctctttccgtggacgatg
agcgatttctcgctgatggacgctatcgaatgcggcatcgtcaagttgccgcgcgtgccg
gtcgccgacaacattcccggtgcggaaatgcccatctatcgtgagctctggaagcacata
ggcaagaagatgccgaagaaggggcgcggcaaaaacgcccagctcgatccattggccatc
ccggtggaattgcagaccgcactggaagctctgtacggccactacctcaaaacctacgaa
gcttggaagcaggcaggcatcaacgttccgccatgcttcattgtggtgtgcaacaacacc
gcaacttccaaactggtgttcgattacatctccggcttcgagcgcacgaatgaggatggc
tccagcacgcgtgtgccaggccggttggagctgttccgcaacttcgacgaacatggcgag
ccgctggcgcgcccaaacaccttgctgatcgacagcgagcaactcgaatctggcgaggcg
ctggacgataacttccgggggatggccgccgacgagatcgaacgcttcaagcgcgagatc
atcgagcgcaccggcgatcgcggccaggctgagaacctgagtgacagcgaattgctgcga
gaggtaatgaacaccgtgggcaagcagggccgcttgggcgaacaaattcgctgcgtggtg
tcggtgtccatgctcacggaaggttgggatgccaataccgttacccacatcctcggggtg
cgtgcgttcggcacccaactgctgtgcgagcaggtgattggccgtgccctgcgtcgtcag
tcctatgaattgaacgaacaaggcctctttgacgtggagtacgccgacgtattcggcatc
cccttcgacttcacagccaaaccagtcgtcgtcacgccgcccaagccccgcgaaaccatc
acagtcaaggcactgcgcccggaacgcgatcatctggaaatctggttcccgcgcgtgcag
ggctatcgcgtcgagctgccagaagaacaactcgaagctgaattcaacgacgaccaccac
gtcagcctgacgcccgacagggttggtgcgaccaagacccacaacgccggcatcattggc
gaggcagtggagctggatatcaagcatctgggagacgtgcgccagtccaccctgctgatg
gagttgaccaagcatctgctgttccagcattggcgtgataaaggccaggatgcaccgatt
gcattgtttggtcagctcaagcgcatcgtgcgccagtggctggacgagtgcctggagtgc
aagggcggcacgtatccggcgcagttgatgtaccgcgaactggcggacatggcctgccag
cgcatcaccaagggtattaccgcgaaggaactggaaaagggccggcaggtcaaagccatc
ctcgacccattcaacccgaccggcagcaccgcgcacgtgcgtttcaacacttcgcgtccg
ggcagtgaacgctgggaaaccctcggtgtagagaaccagccgaaaaaccaggtcaactgg
gtgattctggacagcggctgggaaggcgaattctgtcgcatcgccgaatcgcatcccaag
gtgctggcctacaccaagaaccacaacctcggcctggaagtaccctaccgctttggctcg
gccaaccgcatctacatacctgacttcatcgttcaagtggacgatggtcgcggcaagaac
gattcactgaatctgatcgtcgagatcaagggctaccggcgcgaagatgcgaaggagaag
aagtccaccatggacacctactggattcctggcgtgaaccacctcggcacacacggtcgc
tgggccttcgtcgagtttggtgacgtttacgaaatgcaggatgacttcgccaaagaggtc
gaggcgaagttcaaccaaatgattgaaacggctgtgcccgcgccgggaaacaaggaatac
tga

DBGET integrated database retrieval system