KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1077Help
Entry
XCC1077           CDS       T00083                                 

Gene name
srfJ
Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    XCC1077 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XCC1077 (srfJ)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     XCC1077 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242319..1243638
Genome map
AA seq 439 aa AA seqDB search
MRVSTVDVPTAGHALTEKENSIFVNPQRRFQALLGIGGAITDSSAETFAKLPKQAQRQLL
TAYYDPDKGIGYTLARTTIHSSDFSSGSYTYIKEGDAALKTFSVQHDAKYRIPMLRQAIA
AAGGTLTTFASPWSAPAFMKDSNAMLKGGKLLPEYAQAWATYYTRFIAAYEKAGIPIWGI
SLQNEPMAVQTWESMLFSAEEERDFLKNHLGPTMAKAGYGDRKIIVWDHNRDMMVHRAHV
IFDDPEASKYAWGMGFHWYETWAGFAPMVENVAAVAQAYPDKHLLLTEAAVEKFDPAKLQ
HWPNGERYGTAIINDLNHGAVGWTDWNILLDEHGGPNHVGNYCFAPVHANTRTGEVIYTP
SYWYIGHFSKFIRPGAQRVSAASSRSNLATTAFVNSDGSLATVVMNATDVAIRYNLYVGD
ASSVLEIPAHAIQTVVLAQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcagcactgtcgatgtgcccacggcagggcatgcgttgaccgagaaagagaat
tccatcttcgtcaatccacagcggcggtttcaggcgttgctgggcattggcggggcgatc
accgattccagcgcggaaaccttcgccaaactgcccaagcaggcgcagcggcaactgctc
accgcctactacgacccggacaagggcatcggctacacgctggcgcggaccaccatccat
agctcggatttcagcagtggcagctacacctatatcaaggaaggcgacgcggcgctgaag
accttttcggtgcagcacgatgcgaaataccgcattccgatgctgcgccaggccattgct
gcggccggtggcacgctcaccacgtttgccagcccgtggagcgcgccggccttcatgaaa
gacagcaacgccatgctcaagggcggcaagctgttgcccgaatatgcgcaggcctgggcc
acgtactacacgcgcttcattgccgcgtatgaaaaggccggcatcccgatctggggcatc
agcctgcagaacgagccgatggcagtgcagacctgggagtcgatgctgttttctgcggaa
gaagagcgcgactttctcaagaatcatctgggccccaccatggccaaggccggctatggc
gatcgcaagatcatcgtgtgggaccataaccgcgacatgatggtgcaccgcgcgcatgtg
atcttcgatgatccggaggcttccaaatatgcgtggggcatgggcttccactggtacgaa
acctgggccgggttcgcgccgatggtggagaacgtggcggcggtggcacaggcgtacccg
gacaagcacctgctgctcaccgaagcggcggtggaaaagttcgacccggccaagctgcag
cactggcccaatggcgagcgctatggcacggccatcatcaacgacctcaatcacggtgcg
gtgggttggacggactggaacatcctgctggacgagcacggtggccccaatcacgtgggc
aactattgctttgcaccggtgcatgccaacacgcgcaccggcgaggtgatctacacgccg
agctattggtatatcggccacttttccaagttcatccggcctggcgcgcagcgggtgagt
gcggcgagcagccgcagtaacctggctaccactgcgttcgtcaacagcgatggcagcctg
gcgacggtggtgatgaatgccacggatgtggcgatccgctacaacctgtatgtgggcgat
gcctccagcgtgctggagattcccgcgcatgcgatccagacggtggtgctggcgcagtga

DBGET integrated database retrieval system