KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1192Help
Entry
XCC1192           CDS       T00083                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xcc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xcc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1392052..1393152
Genome map
AA seq 366 aa AA seqDB search
MAPLCSPLTSSAGVFMQRVFGTLADGVQVHALRLRGDGDLEAEVLTYGGILHALELTTPQ
GRVPLVLTLPDLPAYAADNDSLNILVGRFGNRIAGARYTLDGVTHVLAANEGRNQLHGGL
HGFGRRVWEVLEQAPNRVVLGYTSPDGEEGYPGTLQVRAQLQVQGNRLHLDFEAQCDAPT
PLNLTHHPYFNLSGDPQTRAASQVLRVPAERYLPVDAESIPTGEIASVAGTPFDFRTPAA
LAERIDPAHPQVVLGKGYDQCLVLAKDAHNDCIAELYSPQSGVALRITSDAPAVQLYEGQ
HLDSHHPGLGRGVCLEPQDYPDAPNQPAFPSAILRPGQVYRRRIAYHFAAPGPEQPWTSV
IAALNA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccgctatgctcgccgctcacttcatcggcgggtgtcttcatgcagcgagtgttc
ggaaccttggcggacggtgtccaggtgcatgcgctgcgcttgcgtggcgatggcgacctg
gaagcggaagtgctcacctacggcggcatcctgcacgcgctggaactgaccaccccgcaa
ggccgcgtgccgctggtgctgacactgcccgatctgcccgcctacgccgccgacaacgac
agcctcaacatcctggtcggccgcttcggcaaccgcatcgctggcgcccgctacaccctg
gacggcgtgacccatgtgctcgccgccaacgaagggcgcaatcagctacatggggggctg
catggcttcgggcggcgcgtgtgggaggtgctggagcaggcgccgaaccgggtggtgctc
ggctacacctcgcccgatggcgaggaaggctaccccggcaccttgcaggtacgcgcgcag
ctgcaggtgcagggcaatcgcctgcatctggatttcgaagcgcagtgcgatgcccccacg
ccgttgaacctcacccatcacccgtatttcaatctgtccggtgacccgcagacacgcgcg
gcctcgcaggtattgcgcgtgcctgcggagcgctatctgcccgtggatgccgaatcgatt
ccgaccggcgaaattgcctcggtcgcggggacgcccttcgatttccgcacgcctgctgcg
ctggccgagcgcatcgaccctgcgcatccgcaggtggtgctcggcaagggctacgaccag
tgcctggtgctggcgaaggacgcgcacaacgactgcatcgccgagctgtactccccgcag
agcggcgtcgcgctgcgcatcaccagcgatgcgccggcggtacagctgtacgaaggccag
catctggatagccaccatcccggcctgggccgtggcgtctgcctggaaccgcaggactat
ccggatgcgcccaatcagccagcgttcccgtcggcgatcctgcgcccgggccaggtatat
cggcggcgcattgcctaccactttgcggcccccgggccggagcagccgtggacgtcggtg
atcgctgcgctgaatgcgtga

DBGET integrated database retrieval system