KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1256Help
Entry
XCC1256           CDS       T00083                                 

Gene name
bga
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XCC1256 (bga)
  Lipid metabolism
   00600 Sphingolipid metabolism
    XCC1256 (bga)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XCC1256 (bga)
Enzymes [BR:xcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XCC1256 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1465924..1468704)
Genome map
AA seq 926 aa AA seqDB search
MDQQQLQNTLGHRLVVGERQLLRFPAQQRSAAGDRLHAPSVYRRACIASLRSRQACYRHA
RRRCRQQEGAAMTGINRRELLRGMLASGVRAALPAGAAGALLPGSADAAPAAAKDATPLA
PLGDASLAPRERLLFDFGWRFHPGHASDPSRDFEFGTFQRTFAKAGKDTATAAQLAFDDS
NWQQVDLPHDWAVTLPFRPEPISASMTEEDPAAAHGYKALGTSFPENSVGWYRRMLQIPA
SDLGKRICLVFDGVFRDCVVFCNGHIVGRNASGYCGFEVDLSEVLDYGKPNLIVVRVDAT
LGEGWFYEGAGIYRHLWLQKTDPLHVPQHGVFVRSSVQGDTATAQLSTEVRNDGTASRQC
VVQARITAPYGRIVAQAASAAVTVAPGQVQVVEQTVPLGQAALWSIDTPQLYTLTTSVHS
AGVAVDALVTPFGVRSIAFDAQRGFLLNGAPLKLHGTNNHQDHAGVGTAIPDALHAWRLR
QLKSMGCNAYRSSHNPATPELLALCDRLGMFVIEETRRMSTDPEAMAELETMVRRGRNHP
SVILWSLGNEEPQQVTERGARIVTRMQQRVRQLDPTRPTTFAMDKGFGDGVGQVVDVVGF
NYRTSQMDGFHAQYPNIPIYGSETGSTVSVRGNYQRDDTRGYTRAYDTDHPWWASTAEAW
WSYVAQRPYIAGGFIWTGFDYRGEPTPYNRWPNVGSQFGVLDSCGFPKDNYWYYRAQWTS
EPVLHLFPHWNWDGLLQPDDKGRVEVWCHSNLEAVELLVNGVSQGLQQVPAYGHVEWRVA
YAPGVIEARGYRGGKLVLTERRETVGKPAAIRLSCDRSALRADAEDVAVVKVEIVDAQGR
LVPNADHLVHLVLRGPARLIGVGNGDPSSHEDDKAPQRKAFNGLCMALLRSTRSSGQILL
QATAPGLTSAALHLQAATSALRPSVD
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcagcagctgcaaaacacgctggggcaccggctcgtcgtgggagaacgccag
cttcttcgatttccagcacaacaacgaagtgctgccggcgatcgacttcatgcgccatcc
gtataccggcgtgcctgcatcgcatcgctccgaagcaggcaagcctgctatcgacacgca
aggcgacgctgccgacaacaagagggcgcagccatgaccggcatcaatcgccgcgaatta
ctgcgcggcatgttggcaagtggcgtgcgtgccgcactcccggccggtgcagccggtgcg
ctgttgcccggcagtgcggatgcagcgccagccgcggcgaaagatgccacgccgctcgcc
ccgctcggcgatgcaagcctggcaccacgcgaacggctgctgttcgacttcggttggcgg
ttccatcccggccatgccagcgacccatcgcgcgacttcgagttcggcaccttccagcgc
accttcgccaaggccggcaaggacaccgccaccgccgcgcaactggccttcgacgacagc
aactggcaacaggtggacctgccgcacgactgggccgtgaccctgcccttccgtccggag
ccgatctccgcctcgatgaccgaagaagacccggcggccgcgcacggctacaaggcgctg
ggcacgagctttccggaaaacagcgtgggctggtatcggcgcatgctgcagatcccggcc
agcgatctgggcaagcgcatctgcctggtgttcgacggcgtgttccgcgattgcgtggtg
ttttgcaacggccacatcgtcgggcgcaacgccagcggctattgcggcttcgaggtcgac
ctgagcgaagtgctcgactacggcaagcccaacctcatcgtcgtgcgcgtggatgccacg
ctcggcgaaggctggttctatgaaggcgccggcatctaccggcatctgtggctgcagaag
accgacccgctgcacgtgccgcagcatggcgtgtttgtgcgcagcagcgtgcaaggcgac
accgccaccgcgcagctttccaccgaagtgcgcaacgacggcaccgcgtcacgccagtgc
gtggtgcaggcccgcatcaccgcaccgtatggacgcatcgtggcgcaagcggccagcgca
gcggtcacggttgcgcccggtcaggtacaggtcgtcgaacagaccgtgccgctcggccag
gccgcgttgtggtcgatcgacaccccgcagctctacaccctcaccaccagcgtgcacagc
gcaggggttgcggtcgatgcgcttgtcacaccgttcggcgtgcgcagcatcgctttcgat
gcgcaacgcggctttctattgaatggtgccccgttgaaattgcacggcaccaataatcac
caggaccatgccggcgttggcacggccattcccgatgccttgcacgcatggcgcctgcgc
cagctcaagtcgatgggctgcaacgcgtatcgcagctcgcacaatccggccacccccgaa
ctgctcgcgctgtgcgaccgcctgggcatgttcgtgatcgaagaaacccggcgcatgtcc
accgacccggaggcaatggccgaactggagacaatggtccggcgcgggcgcaaccacccc
agcgtgatcctgtggtcgctcggcaacgaagagccgcaacaggtcaccgaacgcggcgcg
cgcatcgtcacgcgcatgcagcaacgcgtgcgccagctcgaccccacccgccctactacg
ttcgccatggacaagggctttggcgacggcgtgggccaggtggtggatgtggtcggcttc
aactaccgcaccagccagatggacggcttccacgcgcaatatcccaatattccgatctac
ggcagcgaaaccggcagcaccgtctcggtgcgcggcaactaccagcgcgacgatacccgc
ggctacacccgcgcctacgacaccgaccacccgtggtgggccagcactgccgaagcctgg
tggagctacgtcgcgcaacgcccgtacatcgccggcggctttatctggaccggtttcgat
taccgcggcgaacccacaccctacaaccgctggccgaatgtcggctcgcaattcggcgta
ttggatagttgcggctttcccaaggacaactactggtactaccgcgcgcagtggaccagc
gagccagtgctgcatctgttcccgcactggaactgggacggtctgctgcagcccgatgac
aaaggccgcgtcgaggtctggtgtcacagcaatctcgaagcggtggaactactggtcaac
ggcgtcagccagggcctgcagcaggtgcctgcctacggccatgtcgaatggcgcgtggca
tacgcaccgggcgtgatcgaagcgcgcggctatcgcggcggcaaactggtgctcaccgaa
cgccgtgaaaccgtcggcaagccggcagcgatccgcctgagttgcgatcgcagcgcactg
cgcgccgatgccgaagatgtggcggtggtgaaagtggagatcgtcgatgcgcaaggccgg
cttgtaccgaatgccgaccacctggtgcacctcgtcctgcgtggacctgcacgtctgatc
ggcgtgggcaacggcgaccccagcagccacgaagacgacaaggcgccgcagcgcaaggca
tttaacggcttgtgtatggcgttgctgcgaagcacgcgcagcagcggccagatcctgctg
caggccaccgcgccaggcctgacctcggcagcgctgcatctgcaggctgccacgtcggcc
ttgcggccgtcggtcgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system