KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1332Help
Entry
XCC1332           CDS       T00083                                 

Gene name
desC
Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xcc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:xcc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1550484..1551533)
Genome map
AA seq 349 aa AA seqDB search
MSAASVKGPIHHGEPCVPSSGLDPRVAPTPHPATPPQRAGKARRFGSLRRWVDSQTDEPL
DEARADRIDWLRALPFIALHLACFAVFWVGVSWFAVSMAVALYALRMFALTGFYHRYFSH
RAFKTSRVVQFVFAAIAATCVQRGPLWWAAHHRNHHRHTDTGRDPHSPAQHGFWWSHTGW
FLTPRNFRTDWEVIPDLRRFTELRFLDRFDIVMPVLLALGLYLLGDWLAAAAPGLHTSGA
QLLVWGFVLSTVALFHATFTINSLAHRFGSRRFDTRDDSRNNWLLALLTFGEGWHNNHHF
FPGSARQGVRWWEYDMTWYGLTVMSWVGLVWDLKPMPAMLTRRAGRVAR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggcagcatccgtaaagggtcccatccaccacggagaaccatgcgtgccgagctct
ggactcgacccccgcgtcgcacccacgccccaccccgccaccccgccacagcgcgcgggc
aaggcccggcggttcggcagcctgcgtcgctgggtggattcgcaaaccgacgaaccgctg
gacgaagcccgcgcggaccgcatcgactggctgcgtgcgctgccgttcatcgccttgcac
ctggcctgctttgcggtgttctgggtcggtgtgtcgtggttcgcagtgagcatggccgtg
gcgctgtacgcgctgcgcatgttcgcgctgaccgggttctatcaccgctatttctcgcac
cgcgcattcaagacctcgcgcgtggtgcagttcgtgttcgccgcgatcgccgccacctgc
gtgcaacgtgggccgctgtggtgggccgcacaccatcgcaaccatcaccggcataccgac
accggccgtgacccgcattcgccggcacagcacggcttctggtggagccataccggctgg
ttcctgaccccgcgcaatttccgcaccgattgggaagtgattccggatctgcgccgcttc
accgagctgcgatttctggaccgcttcgacatcgtgatgccggtgctgctggcactgggc
ctgtacctgctgggcgactggctggcggctgcagcgcctggcctgcacaccagtggcgcg
cagttgctggtgtggggcttcgtgctgtccacggtggcgttgttccatgccaccttcacc
atcaattcgctggcgcaccgcttcggcagccggcgcttcgacacccgcgacgacagccgc
aacaactggttgctggcgctgctcaccttcggcgagggctggcacaacaaccatcatttc
tttcccggctcggcgcgccagggcgtgcgttggtgggaatacgacatgacctggtacggg
ctcacggtgatgtcgtgggtgggcctggtgtgggatctcaaaccgatgcccgccatgctg
acgcgacgcgccggacgggtggcgcgatga

DBGET integrated database retrieval system